Print…

You Searched For: DISTRIBUTION+RESULTS,+INC.


50,626  results were found

Refine Results Sort by
SearchResultCount:"50626"

Sort Results

List View Easy View

Rate These Search Results

Product Image-10090-138

Anti-MLPH Rabbit Polyclonal Antibody

Catalog Number: (10090-138)
Supplier: Proteintech
Description: Melanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft.
Product Image-10051-694

Anti-PTPRC Mouse Monoclonal Antibody [clone: UCHL1]

Catalog Number: (10051-694)
Supplier: Tonbo Biosciences
Description: The UCHL1 antibody reacts with the human CD45 isoform known as CD45RO, a protein tyrosine phosphatase of 220 kDa. CD45 is one of the most abundant hematopoietic markers, and is expressed on all leukocytes (the Leukocyte Common Antigen, LCA). Various isoforms are generated and expressed in cell-specific patterns. With their broad cell distribution, CD45 isoforms are critical for many leukocyte functions, regulating signal transduction and cell activation associated with the T cell receptor, B cell receptor, and IL-2 receptor. Other forms of CD45, with restricted cellular expression, include CD45R (B220), CD45RA and CD45RB.
Product Image-10128-566

Water, Ultrapure for PCR, deionized, sterile

Supplier: QUALITY BIOLOGICAL, INC.
Description: PCR Water is useful for PCR Assays (i.e rRT-PCR, etc.).

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Product Image-MFLX75650-92

GoatThroat™ Spillproof Barrel Pump Accessories

Supplier: WESTCOTT DISTRIBUTION
Description: Enhance versitility of your GoatThroat™ Spillproof Barrel Pump.

Product Image-10103-416

Anti-PSMD8 Rabbit Polyclonal Antibody

Catalog Number: (10103-416)
Supplier: Prosci
Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
Product Image-10109-586

Anti-PSME3 Rabbit Polyclonal Antibody

Catalog Number: (10109-586)
Supplier: Prosci
Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.
Image Unavailable-CAPIPA525944

Anti-CA5B Rabbit Polyclonal Antibody

Catalog Number: (CAPIPA525944)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with rat based on sequence homology. CA5B belongs a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. This protein is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. The protein has a wider tissue distribution than CA VA, which is restricted to the liver.
Product Image-10100-524

Anti-PSMA2 Rabbit Polyclonal Antibody

Catalog Number: (10100-524)
Supplier: Prosci
Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Image Unavailable-76116-472

Anti-CAMK4Thr196 + Thr200 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76116-472)
Supplier: Bioss
Description: Ca2+/calmodulin dependent protein kinase type IV (CAMKIV) belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.
Product Image-76436-786

CE MicroIntensive™ G Duo Mop, Vileda Professional

Catalog Number: (76436-786)
Supplier: VWR International
Description: Single-use mop, superior results. Double-sided mop is twice as efficient as single-sided mops.
Product Image-10092-662

Anti-PPM1A Rabbit Polyclonal Antibody

Catalog Number: (10092-662)
Supplier: Proteintech
Description: PPM1A(Protein phosphatase 1A) is also named as PPPM1A and belongs to the PP2C family. It is a serine/threonine protein phosphatase that is essential for regulating cellular stress responses in eukaryotes. PPM1A plays an important role in tumor suppression and that it negatively controls many signaling pathways which are critical for trophoblast invasion.. This protein distributes in both the cytoplasm and nucleus of mammalian cells. It has 2 isoforms produced by alternative splicing.
Image Unavailable-10486-412

Anti-POLB Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10486-412)
Supplier: Bioss
Description: Repair polymerase that plays a key role in base-excision repair. Has 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity that removes the 5' sugar phosphate and also acts as a DNA polymerase that adds one nucleotide to the 3' end of the arising single-nucleotide gap. Conducts 'gap-filling' DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases.
Product Image-10082-056

Anti-CRISP3 Rabbit Polyclonal Antibody

Catalog Number: (10082-056)
Supplier: Proteintech
Description: CRISP3, also known as SGP28, is a glycoprotein that belongs to a family of cysteine-rich secretory proteins (CRISPs). CRISP3 was originally discovered in human neutrophils, but transcripts are widely distributed in exocrine glands (salivary glands, pancreas, and prostate) and also found at lower levels in epididymis, ovary, thymus, and colon. CRISP3 is a potential biomarker for prostate cancer. This antibody can recgnize both CRISP2 and CRISP3.
Image Unavailable-10434-324

Anti-SULT1A1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10434-324)
Supplier: Bioss
Description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
Image Unavailable-10230-602

Anti-NTRH Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10230-602)
Supplier: Bioss
Description: Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active.
Image Unavailable-102999-330

Human Glucagon-Like Peptide 1, GLP-1 (7-36), amide

Supplier: Anaspec Inc
Description: GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
977 - 992 of 50,626
no targeter for Bottom