Print…

You Searched For: DISTRIBUTION+RESULTS,+INC.


50,626  results were found

Refine Results Sort by
SearchResultCount:"50626"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103010-752

5(6)-Carboxyfluorescein

Supplier: Anaspec Inc
Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Image Unavailable-103003-754

Human Angiotensin II Substrate

Catalog Number: (103003-754)
Supplier: Anaspec Inc
Description: This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-75841-670

Anti-CD3 Rat Monoclonal Antibody [clone: 17A2]

Catalog Number: (75841-670)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 17A2 monoclonal antibody specifically reacts with the mouse T lymphocytes receptor (TCR) associated CD3 complex, resulting in cellular activation and proliferation. CD3 is expressed by thymocytes and mature lymphocytes, and contains γ, δ, and ε subunits, involved in the assembly, trafficking, and surface expression of T-cell receptor complex. The interaction between the T lymphocytes and the 17A2 antibody can be blocked by the 145-2C11 anti-CD3e antibody, demonstrating that the 17A2 antibody recognizes the CD3 ε chain.
Image Unavailable-103010-552

Mouse Recombinant Renin (from HEK293 cells)

Catalog Number: (103010-552)
Supplier: Anaspec Inc
Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay
Product Image-10083-486

Anti-BAG1L Rabbit Polyclonal Antibody

Catalog Number: (10083-486)
Supplier: Proteintech
Description: BAG1 have been identified that modulate gene transcription through poorly defined mechanisms. Four isoforms of the BAG1 protein (BAG1S, BAG1, BAG1M and BAG1L) can be produced from a common mRNA by use of alternative translation initiation sites, including a non-canonical CTG codon in one instance. The longest, BAG1L (Mr ~50K), contains a nuclear localization signal (NLS) and resides in the nucleus, whereas BAG1M (Mr ~46K) has an incomplete NLS and distributes mainly in cytosol, unless dragged into the nucleus through interactions with other. Distribution of BAG1S(p33) is not clear yet. This antibody can recognize BAG1L and BAG1V.
Product Image-KT287801-0000

Accessories for KIMBLE® Cow Type Distillation Receiver with Three Receivers and 14/20 [ST] Joints, DWK Life Sciences

Catalog Number: (KT287801-0000)
Supplier: DWK Life Sciences (KIMBLE)
Description: Distribution Adapter Cow-type design having three receivers spaced 45 apart. Condensers with drip joints will protrude into the spherical section, keeping wetted surfaces and product hold-up to a minimum.
Product Image-10105-326

Anti-ACSL1 Rabbit Polyclonal Antibody

Catalog Number: (10105-326)
Supplier: Prosci
Description: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Image-10108-678

Anti-TMEM8B Rabbit Polyclonal Antibody

Catalog Number: (10108-678)
Supplier: Prosci
Description: Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.
Image Unavailable-77438-856

Anti-PACE4 Rabbit Polyclonal Antibody

Catalog Number: (77438-856)
Supplier: Bioss
Description: Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.
Product Image-10104-522

Anti-CA1 Rabbit Polyclonal Antibody

Catalog Number: (10104-522)
Supplier: Prosci
Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.
Image Unavailable-75841-676

Anti-CD3 Rat Monoclonal Antibody [clone: 17A2]

Catalog Number: (75841-676)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 17A2 monoclonal antibody specifically reacts with the mouse T lymphocytes receptor (TCR) associated CD3 complex, resulting in cellular activation and proliferation. CD3 is expressed by thymocytes and mature lymphocytes, and contains γ, δ, and ε subunits, involved in the assembly, trafficking, and surface expression of T-cell receptor complex. The interaction between the T lymphocytes and the 17A2 antibody can be blocked by the 145-2C11 anti-CD3e antibody, demonstrating that the 17A2 antibody recognizes the CD3 ε chain.
Image Unavailable-103006-440

Human GIP (3-42)

Catalog Number: (103006-440)
Supplier: Anaspec Inc
Description: This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-75841-688

Anti-CD3 Rat Monoclonal Antibody (APC (Allophycocyanin)-Cy7®) [clone: 17A2]

Catalog Number: (75841-688)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 17A2 monoclonal antibody specifically reacts with the mouse T lymphocytes receptor (TCR) associated CD3 complex, resulting in cellular activation and proliferation. CD3 is expressed by thymocytes and mature lymphocytes, and contains γ, δ, and ε subunits, involved in the assembly, trafficking, and surface expression of T-cell receptor complex. The interaction between the T lymphocytes and the 17A2 antibody can be blocked by the 145-2C11 anti-CD3e antibody, demonstrating that the 17A2 antibody recognizes the CD3 ε chain.
Image Unavailable-75842-646

Anti-Foxp3 Rat Monoclonal Antibody (PE (Phycoerythrin)) [clone: MF23]

Catalog Number: (75842-646)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The MF23 monoclonal antibody specifically reacts with the mouse 50-55 kDa Foxp3 protein (JM2, IPEX), a member of the forkhead family of transcription factors. Foxp3 is expressed by the Treg lymphocytes, whose development and function are influenced by the forkhead protein. Ectopic expression of Foxp3 in T lymphocytes inhibits their activity and cytokine expression. Mutations of Foxp3 result in the “scurfy” mice phenotype. It is reported that the MF23 antibody recognizes an epitope between 1-87 amino acids in the N-terminal domain of mouse Foxp3.
Image Unavailable-75844-390

Anti-CTLA4 Mouse Monoclonal Antibody [clone: BNI3]

Catalog Number: (75844-390)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The BNI3 monoclonal antibody specifically reacts with human CD152, the Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4). CTLA-4 is expressed on activated CD28+ T cells, and binds the B7 family members B7-1 (CD80) and B7-2 (CD86). The structure of CTLA-4 is similar to the structure of CD28, but the two molecules seem to have opposite roles on the T lymphocytes. CTLA-4 inhibits the progression of T cell activation, while CD28 stimulates it. This result explains the stimulating role that the immobilization of BNI3 plays on the T lymphocytes proliferation induced by CD28.
Product Image-10090-620

Anti-NDEL1 Rabbit Polyclonal Antibody

Catalog Number: (10090-620)
Supplier: Proteintech
Description: Nuclear distribution factor E-homolog 1 (NDE1), NDE-like 1 (NDEL1), and Lissencephaly 1 (LIS1) together involve in essential neurodevelopmental processes, including neuronal precursor proliferation and differentiation, neurite outgrowth, and neuronal migration. All three bind directly to Disrupted in Schizophrenia 1 (DISC1), a scaffold protein critical to neuronal proliferation, integration, migration, and synaptic function within the developing and adult brain. Nuclear distribution element-like 1 (NDEL1) was firstly identified as a regulator of the cytoskeleton in microtubule and intermediate fliament dynamics and microtubule-based transport . It is required for organization of the cellular microtubule array and microtubule anchoring at the centrosome, which is in part by targeting the microtubule severing protein KATNA1 to the centrosome.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
529 - 544 of 50,626
no targeter for Bottom