Print…

You Searched For: DISTRIBUTION+RESULTS,+INC.


50,632  results were found

Refine Results Sort by
SearchResultCount:"50632"

Sort Results

List View Easy View

Rate These Search Results

Product Image-14201-048

SP Wilmad-LabGlass Reaction Kettle Heating Mantles, SP Industries

Catalog Number: (14201-048)
Supplier: SP Industries
Description: These all-glass constructed heating mantles are for use with LG-8071 through LG-8089 reaction kettles. They provide even heat distribution.
Image Unavailable-103010-438

SMCC Activated CL - APC

Catalog Number: (103010-438)
Supplier: Anaspec Inc
Description: Cross-linked Allophycocyanin (CL-APC), highly fluorescent stabilized phycobiliprotein, is chemically modified with SMCC. SMCC reacts with the primary amine on CL-APC and introduces maleimide groups to APC. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of APC with proteins. These conjugates are widely used in applications such as flow cytometry, live cell staining, and immunofluorescent staining.
Image Unavailable-CA95021-882

BYE Agar Dehydrated Culture Media, HiMedia

Catalog Number: (CA95021-882)
Supplier: HiMedia
Description: For the cultivation and routine studies of distribution of Mycoplasmas or Pleuropneumonia-like organisms (PPLOs) and L-forms of bacteria.

SDS


Product Image-89215-208

Rotary Evaporator Valves, Ace Glass Incorporated

Supplier: Ace Glass
Description: Valve distribution head inlet assembly glass body only part 41346

Small Business Enterprise Product available on GSA Advantage®

Image Unavailable-103011-288

Collagen (Type I) (Soluble)

Catalog Number: (103011-288)
Supplier: Anaspec Inc
Description: Besides water-soluble collagen (Type I) conjugate (Cat#85111), AnaSpec also offers water-insoluble fluoresceinated collagen (type I). It can also be used for fluorometric measurement of collagenase activity. Cat#85102 is the water-insolulbe collagen that is heavily labeled with FITC, resulting in almost total quenching of the conjugates fluorescence. Protease-catalyzed hydrolysis slowly yields brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. Although this fluoresceinated collagen is more slowly digested by MMP-1 than water-soluble collagen (Cat#85111), it is more specific for the enzyme.
Product Image-89219-006

Medicine Cups, Medegen Medical Products

Catalog Number: (89219-006)
Supplier: Medegen Medical Products, LLC
Description: This medicine cups are used in health care, dental care and other human service industries is to provide a safe way to distribute medication to patients
Image Unavailable-103006-544

Human [Gly22]-beta-Amyloid (1-40)

Catalog Number: (103006-544)
Supplier: Anaspec Inc
Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the arctic mutant, Glu 22 is replaced with Gly, resulting primarily in increased formation of Aβ protofibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Molecular Weight: 4257.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-77438-194

Anti-TOR1AIP2 Rabbit Polyclonal Antibody

Catalog Number: (77438-194)
Supplier: Bioss
Description: Regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope.
Product Image-470027-988

Coyote Skull

Catalog Number: (470027-988)
Supplier: SKULLS UNLIMITED
Description: Coyotes have adapted well to living near human habitation and are now distributed over much of North America, including the east coast.
Product Image-60000-732

Synthware Gas Washing Bottle with Fritted Disc and Two Hose Connections, Kemtech America

Supplier: Kemtech America
Description: Gas washing bottle with [ST]45/50 cap-style stopper and fritted disc angled at 15° for even distribution of gas throughout absorbing material.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Image Unavailable-103870-972

Anti-Rituximab Hybridoma Polyclonal Antibody(FITC Labeled Protein)

Catalog Number: (103870-972)
Supplier: ACROBIOSYSTEMS INC MS
Description: Rituximab Monoclonal Antibody, Source: produced from a hybridoma resulting from fusion of SP2/0 myeloma and B-lymphocytes obtained from a mouse immunized with Rituximab F(ab')2, Isotype: IgG1/kappa, Purity: greater than 95%, FITC-Labeled, Size: 200uG
Product Image-10109-492

Anti-CBR1 Rabbit Polyclonal Antibody

Catalog Number: (10109-492)
Supplier: Prosci
Description: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.
Image Unavailable-77972-130

Cimarec™ I Mini Stirrers

Supplier: Thermo Fisher Scientific
Description: <p>Work in the smallest of places with Thermo Scientific™ Cimarec™ i Mini Stirrers. The i Mini Series stirrers come with or without your choice of controller for use with the distribution system.</p>

New Product

Product Image-76180-450

EXPERT™ Universal Fit Filter Tips, Gilson

Supplier: GILSON, INC.
Description: PIPETMAN® EXPERT Tips are designed to fit leading pipette brands, allowing you to stock one brand of tips saving time, money, and bench space. EXPERT Filter Tips feature a patented, low-retention polymer that creates a hydrophobic surface, ensuring complete dispensing of the sample for more accurate results. The tips are equipped with a polyethylene filter to prevent aerosol-born contamination.

Certificates

Product Image-104014-954

Human FGFR1/β-KLOTHO Luciferase Reporter Assay Kit

Supplier: INDIGO BIOSCIENCES INC MS
Description: Eliminate weeks of cell culture while achieving superior sensitivity with reproducible results from this all-inclusive cell-based luciferase reporter assay. INDIGO’s Fibroblast Growth Factor Receptor 1c and β-Klotho reporter assay allows you to quickly screen test samples to quantify functional activity, either agonist or antagonist, they may exert against FGFR/β-Klotho.

Image Unavailable-103007-848

Human Beta-Amyloid (1-40) HFIP

Supplier: Anaspec Inc
Description: Removal of any preexisting structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupt hydrophobic forces in aggregated amyloid preparations, and promotes α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide resulted in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
369 - 384 of 50,632
no targeter for Bottom