You Searched For: (2-Fluorophenyl)acetone


8,952  results were found

Sort Results

List View Easy View
SearchResultCount:"8952"
Description: Interleukin-1 inhibitor
Catalog Number: CAAAJ63775-06
Supplier: Thermo Scientific Chemicals

Description: CaM kinase kinase inhibitor
Catalog Number: 89158-248
Supplier: Enzo Life Sciences


Description: G-Biosciences' Destain I contains approximately 45% methanol and 9% glacial acetic acid. G-Biosciences' Destain II contains approximately 5% methanol and 7% acetic acid.
Catalog Number: CA95043-516
Supplier: G-Biosciences

SDS


Description: CAS Number: 144689-94-1
MDL Number: MFCD08062365
Molecular Formula: C12H18N2O4
Molecular Weight: 254.29
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 86
Catalog Number: TCD3765-5G
Supplier: TCI America

SDS


Description: Isoxadifen-ethyl, Purity: >98%GC, CAS: 163520-33-0, Molecular Formula: C18H17NO3, MW: 295.34, Synonym: 4,5-Dihydro-5,5-diphenylisoxazole-3-carboxylic Acid Ethyl Ester, Ethyl 4,5-Dihydro-5,5-diphenylisoxazole-3-carboxylate, Physical state: Solid, Form: Crystal - Powder, Size: 5G
Catalog Number: TCI0956-25G
Supplier: TCI America

SDS


Description: CAS Number: 606-45-1
MDL Number: MFCD00008423
Molecular Formula: C9H10O3
Molecular Weight: 166.18
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 228
Flash Point (°C): 110
Specific Gravity (20/20): 1.16
Catalog Number: TCA0483-025ML
Supplier: TCI America

SDS


Description: CAS Number: 1570-45-2
MDL Number: MFCD00006428
Molecular Formula: C8H9NO2
Molecular Weight: 151.17
Purity/Analysis Method: >98.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 92
Flash Point (°C): 87
Specific Gravity (20/20): 1.11
Catalog Number: TCI0137-500ML
Supplier: TCI America

Description: CAS Number: 446044-45-7
Molecular Formula: C23H19NO4
Molecular Weight: 373.41
Purity/Analysis Method: >97.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: 42 deg (C=0.2, THF)
Catalog Number: TCA1658-100MG
Supplier: TCI America

SDS


Description: CAS Number: 761446-45-1
MDL Number: MFCD03789252
Molecular Formula: C16H21BN2O2
Molecular Weight: 284.17
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 89
Catalog Number: TCB4364-1G
Supplier: TCI America

Description: CAS Number: 624-45-3
MDL Number: MFCD00017499
Molecular Formula: C6H10O3
Molecular Weight: 130.14
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 196
Flash Point (°C): 72
Specific Gravity (20/20): 1.05
Catalog Number: TCL0044-500G
Supplier: TCI America

Description: CAS Number: 4065-45-6
MDL Number: MFCD00024962
Molecular Formula: C14H12O6S
Molecular Weight: 308.30
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Catalog Number: TCH0466-500G
Supplier: TCI America

Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103006-368
Supplier: Anaspec Inc



Description: CAS Number: 744-45-6
MDL Number: MFCD00046051
Molecular Formula: C20H14O4
Molecular Weight: 318.33
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Melting point (°C): 138
Catalog Number: TCI0416-25G
Supplier: TCI America

Description: PP2A inhibitor
Catalog Number: 89161-762
Supplier: Enzo Life Sciences


Description: Cas Number: 105-45-3, Synonyms: Methyl 3-Oxobutanoate, Methyl 3-Oxobutyrate, Acetoacetic Acid Methyl Ester, for Synthesis, 100Ml
Catalog Number: EM8.00107.1000
Supplier: MilliporeSigma

753 - 768 of 8,952