You Searched For: L-Alanine benzyl ester hydrochloride

Description: A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-252

Supplier: Anaspec Inc

Sale

Description: Reactive pH indicator for slightly acidic pH range

Catalog Number: 103011-388

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-028

Supplier: Anaspec Inc

Sale

Description: This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-606

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine.
Sequence:Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)
MW:3142.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-604

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 488 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Catalog Number: 103010-880

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-25) with acetylation at Lys12 and Lys16. It is biotinylated through a C-terminal GSGSK linker. It has been shown that human histone H4 is preferentially acetylated first at Lys16, then at Lys12. Diacetylated histone H4 has been shown to bind repressor protein TUP1. Acetylation of histone H4 also regulates heterochromatin formation by promoting the binding of bromodomains to p300 and transcription factor TAFII250 and inhibiting interactions with SIR3. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3316.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-070

Supplier: Anaspec Inc

Sale

Description: GRGDS is the cell adhesion sequence of osteopontin that recognizes the avb3 integrin. Osteopontin is overexpressed in experimental models of malignancy.
Sequence:GRGDS
MW:490.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-344

Supplier: Anaspec Inc

Sale

Description: This hypothalamic neuropeptide has been shown to regulate feeding behavior.
Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
MW:3561.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-738

Supplier: Anaspec Inc

Sale

Description: Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-098

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-518

Supplier: Anaspec Inc

Sale

Description: This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103006-812

Supplier: Anaspec Inc

Sale

Description: EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103008-150

Supplier: Anaspec Inc

Sale

Description: This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103007-680

Supplier: Anaspec Inc

Sale

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Catalog Number: 102996-362

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-032

Supplier: Anaspec Inc

Sale