Print…

You Searched For: Calcium+glycerophosphate


5,246  results were found

Refine Results Sort by
SearchResultCount:"5246"

Sort Results

List View Easy View

Rate These Search Results

Product Image-89356-878

Anti-CHP1 Rabbit Polyclonal Antibody

Catalog Number: (89356-878)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to Calcium binding protein P22
Image Unavailable-76100-966

Anti-Camk1g Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76100-966)
Supplier: Bioss
Description: CaMKI gamma is a Calcium/calmodulin-dependent protein kinase which belongs to a proposed calcium-triggered signaling cascade. In vitro it phosphorylates transcription factor CREB1. It has been proposed that CaMKI gamma is involved in dendritic outgrowth mediated by CaM-dependant protein kinase kinase.
Product Image-77510-536

Simian S100A9 (S100 Calcium Binding Protein A9) ELISA Kit

Catalog Number: (77510-536)
Supplier: AFG Bioscience
Description: Simian S100A9 (S100 Calcium Binding Protein A9) ELISA Kit
Product Image-77510-538

Simian S100A8 (S100 Calcium Binding Protein A8) ELISA Kit

Catalog Number: (77510-538)
Supplier: AFG Bioscience
Description: Simian S100A8 (S100 Calcium Binding Protein A8) ELISA Kit
Image Unavailable-89354-278

Anti-NCS1 Rabbit Polyclonal Antibody

Catalog Number: (89354-278)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to NCS1 (neuronal calcium sensor 1)
Product Image-10099-932

Anti-ATP2A3 Rabbit Polyclonal Antibody

Catalog Number: (10099-932)
Supplier: Prosci
Description: ATP2A3 is one of the SERCA Ca (2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.This gene encodes one of the SERCA Ca (2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
Image Unavailable-ABCA_AB319150-1ML

Anti-Calcium Pump PMCA2 ATPase Rabbit Monoclonal Antibody [clone: EPR28923-56]

Supplier: Abcam
Description: Rabbit monoclonal [EPR28923-56] to Calcium Pump PMCA2 ATPase.

New Product

Image Unavailable-77180-820

Anti-S100 Calcium Binding Protein A13 / S100A13 Mouse Monoclonal Antibody [clone: S100A13/7484]

Catalog Number: (77180-820)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S100A13/7484] antibody to S100 Calcium Binding Protein A13 / S100A13 for IHC-P with samples derived from Human.
Image Unavailable-75789-140

Human Recombinant HLP2 (from E. coli)

Catalog Number: (75789-140)
Supplier: Prosci
Description: Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.
Product Image-10106-140

Anti-CACNB1 Rabbit Polyclonal Antibody

Catalog Number: (10106-140)
Supplier: Prosci
Description: The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
Product Image-10106-138

Anti-CACNA2D1 Rabbit Polyclonal Antibody

Catalog Number: (10106-138)
Supplier: Prosci
Description: CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.
Image Unavailable-10666-074

Anti-TRPM3 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10666-074)
Supplier: Bioss
Description: The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].
Image Unavailable-77538-062

Human Calcium/Calmodulin Dependent Protein Kinase II Alpha (CAMK2a) ELISA Kit

Catalog Number: (77538-062)
Supplier: Bioss
Description: Human Calcium/Calmodulin Dependent Protein Kinase II Alpha (CAMK2a) ELISA Kit

New Product


Image Unavailable-10464-160

Anti-ATP2A1 Rabbit Polyclonal Antibody

Catalog Number: (10464-160)
Supplier: Bioss
Description: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
Image Unavailable-10396-940

Anti-BNIP3 Rabbit Polyclonal Antibody

Catalog Number: (10396-940)
Supplier: Bioss
Description: Apoptosis-inducing protein that, which can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2.
Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 5,246
no targeter for Bottom