You Searched For: Calcium+cyanamide


5,155  results were found

SearchResultCount:"5155"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (89319-752)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to NYD-SP26 (chromosome 4 open reading frame 35)


Catalog Number: (76101-820)
Supplier: Bioss
Description: In plant cells, the vacuole functions as a major calcium store. Although a calmodulin-regulated Ca2+-ATPase (ACA4) is known to be present in prevacuolar compartments, the presence of an ACA-type Ca2+-ATPase in the mature vacuole of a plant cell has not been verified. Here we provide evidence that ACA11 localizes to the vacuole membrane. ACA11 tagged with GFP was expressed in stable transgenic plants, and visualized in root cells and protoplasts by confocal microscopy. A Ca2+-ATPase function for ACA11 was confirmed by complementation of yeast mutants.


Catalog Number: (89329-028)
Supplier: Genetex
Description: Rabbit polyclonal antibody to EFCAB4A


Catalog Number: (89417-662)
Supplier: Prosci
Description: EFCAB4B Antibody: EFCAB4B, also known as Calcium release-activated calcium channel regulator 2A, is a novel Ca2+-binding EF-hand protein that is thought to play a key role in store-operated Ca2+ entry in T-cells by regulating CRAC channel activation. EFCAB4B acts as a cytoplasmic calcium-sensor that forms a complex with ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca2+ concentration. A closely related protein, EFCAB4A, is likely to play a similar role as EFCAB4B, but the detailed function of EFCAB4A is still under investigation.


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (89323-636)
Supplier: Genetex
Description: Solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul


Supplier: Biotium
Description: Furaptra, AM ester is a membrane-permeant form of Furaptra (Mag-Fura-2). The indicator is loaded into cells via simple incubation

Catalog Number: (89139-212)
Supplier: Biotium
Description: Mag-Fura-2 is a UV-excitable fluorescent indicator for magnesium with a Kd of 1.9 mM (1,2). Similar to Fura-2, the excitation wavelength of Mag-Fura-2 undergoes a blue shift from 369 nm to 330 nm. Mag-Fura-2 also responds to Ca2+ but with a significantly higher Kd than Fura-2 for Ca2+.


Catalog Number: (75789-140)
Supplier: Prosci
Description: Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.


Catalog Number: (89139-214)
Supplier: Biotium
Description: Mag-Fura-2 is a UV-excitable fluorescent indicator for magnesium with a Kd of 1.9 mM. Similar to Fura-2, the excitation wavelength of Mag-Fura-2 undergoes a blue shift from 369 nm to 330 nm. Mag-Fura-2 also responds to Ca2+ but with a significantly higher Kd than Fura-2 for Ca2+.


Catalog Number: (76083-972)
Supplier: Bioss
Description: PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity.


Catalog Number: (89306-554)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to CaMKII


Catalog Number: (76334-012)
Supplier: Biosensis
Description: Calbindin Monoclonal antibody, Clone: 4H7, Host: mouse, Reactivity: human, horse, cow, pig, rat, Isotype: IgG1, Immunogen: Full-length recombinant human protein, Synonyms: D-28K; Vitamin D-dependent calcium-binding


Catalog Number: (89321-784)
Supplier: Genetex
Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: IHC-P, WB Pkg Size: 100 ul


Catalog Number: (89287-920)
Supplier: Genetex
Description: Mouse Monoclonal antibody to MRP8 + MRP14 (S100 calcium binding protein A8) Clone: 2Q1841 Purity: Purified by affinity chromatography. Species Reactivity: Human Tested Applications: ICC/IF WB Pkg Size: 50 ug


Catalog Number: (76083-974)
Supplier: Bioss
Description: PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
721 - 736 of 5,155
no targeter for Bottom