Print…

You Searched For: Calcium


6,872  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"6872"

Rate These Search Results

Image Unavailable-77982-652

5 10-DIFORMYL-5 6 7 8-TETRAHYDRO FO 10MG

Catalog Number: 77982-652
Supplier: LGC Standards

New Product


Product Image-89318-778

Rabbit Polyclonal antibody to PPEF-1 (protein phosphatase, EF-hand calcium binding domain 1)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89318-778
Supplier: Genetex
Image Unavailable-77180-820

ANTIBODY A316953-100

Catalog Number: 77180-820
Supplier: ANTIBODIES.COM LLC
Image Unavailable-CAPIPA5-14540

CABP1 Polyclonal Antibody 100ug

Description: Host: Rabbit Species Reactivity: Human (Hu ) Immunogen: Synthetic peptide from the C-terminal region of CABP1 conjugated to KLH.
Catalog Number: CAPIPA5-14540
Supplier: Thermo Scientific
Product Image-77526-426

ELISA KIT MOUSE SANDWICH EK248005

Catalog Number: 77526-426
Supplier: AFG Bioscience
Image Unavailable-89318-298

Rabbit Polyclonal antibody to S100A10 (S100 calcium binding protein A10)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89318-298
Supplier: Genetex
Product Image-89354-972

Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: ICC/IF, IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89354-972
Supplier: Genetex
Image Unavailable-102996-094

Parathyroid Hormone (1-34) 1 mg

Description: Parathyroid Hormone (1-34), human, Purity: HPLC >/= to 95%, Molecular Weight: 4117.8, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVF, Appearance: Lyophilized white powder, regulates the metabolism of calcium and phosphate, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-094
Supplier: Anaspec Inc
Image Unavailable-CAPIPA5-15302

TRPM7 Polyclonal Antibody 100ug

Description: Host:Rabbit Species Reactivity:Human (Hu ) Immunogen:Synthetic peptide from the C-terminal region of CHAK1 conjugated to KLH.
Catalog Number: CAPIPA5-15302
Supplier: Thermo Scientific
Image Unavailable-89319-850

Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89319-850
Supplier: Genetex
Image Unavailable-89357-796

Rabbit Polyclonal antibody to Calcium binding protein P22

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: ICC/IF, IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89357-796
Supplier: Genetex
Product Image-89165-944

Fura-2 (ultra Pure) 1 Mg

Catalog Number: 89165-944
Supplier: Enzo Life Sciences
Image Unavailable-75791-160

S100 Calcium Binding Protein A8 Recombinant Protein 50ug

Description: S100 Calcium Binding Protein A8 Recombinant Protein, Species: Mouse, Source: E. Coli, Sequence: Met1-Glu89, Fusion tag: C-6 His tag, Purity: Greater than 95%, Synonyms: S100a8, Caga, Mrp8, Applications: used for biological assays, Size: 50ug
Catalog Number: 75791-160
Supplier: Prosci
Image Unavailable-77178-052

ANTIBODY A315569-100

Catalog Number: 77178-052
Supplier: ANTIBODIES.COM LLC
Image Unavailable-10230-224

CALRETININ Antibody

Description: CALRETININ Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CR; CAL2; CAB29; Calretinin; 29 kDa calbindin; CALB2, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10230-224
Supplier: Bioss
Image Unavailable-10230-228

CALRETININ Antibody

Description: CALRETININ Polyclonal Antibody, Host: Rabbit, Cy5.5 Conjugated, Emmission: 675nm/694nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: CR; CAL2; CAB29; Calretinin; 29 kDa calbindin; CALB2, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10230-228
Supplier: Bioss
1,201 - 1,216 of 6,872