Print…

You Searched For: Bis(3,5-dimethylphenyl)phosphine+oxide


14,252  results were found

Refine Results Sort by
SearchResultCount:"14252"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCV0016-025G

Vanadyl(IV) acetylacetonate ≥95.0% (by titrimetric analysis)

Catalog Number: (TCV0016-025G)
Supplier: TCI America
Description: CAS Number: 3153-26-2
MDL Number: MFCD00000032
Molecular Formula: C10H14O5V
Molecular Weight: 265.16
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Color: Blue

SDS Certificates


Image Unavailable-103007-366

Human [Met(O)35]-beta-Amyloid (1-42)

Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-CA8.08305.0100

Titanyl(IV) acetylacetonate for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Titanyl acetylacetonate, CAS Number: 14024-64-7, Synonyms:: Bis(acetylacetonato)titanium(IV) oxide, Bis(2,4-pentanedionato)titanium(IV) oxide

SDS Certificates

Image Unavailable-CAAAA44517-A7

Titanium(IV) oxide 20 - 35% in water, colloidal dispersion

Supplier: Thermo Scientific Chemicals
Description: Applications: UV protection in clear coatings

Certificates

Product Image-89061-504

Ultraviolet Photo-Oxidation Apparatus, Ace Glass Incorporated

Supplier: Ace Glass
Description: Standard unit for liberation of inorganic phosphate from organically bound phosphorus compounds, oxidation of carbon in organic matter and oxidation of organic nitrogen compounds

Small Business Enterprise Product available on GSA Advantage®

Image Unavailable-CAAA77130-18

Titanyl(IV) acetylacetonate

Supplier: Thermo Scientific Chemicals
Description: Powder

Certificates

Image Unavailable-CAAA12764-06

Bis(dibenzylideneacetone)palladium

Supplier: Thermo Scientific Chemicals
Description: Applications: Hydrogenation, isomerization, carbonylation, oxidation, C-C bond formation

Certificates

Image Unavailable-CAAA10491-06

trans-Bis(triphenylphosphine)palladium(II) chloride Pd ≥ 14.0%

Supplier: Thermo Scientific Chemicals
Description: Applications: Hydrogenation, hydrosilation, carbonylation, oxidation, and C-C bond formation

Certificates

Image Unavailable-TCM0464-5G

Bis(2,4-pentanedionato)molybdenum(VI) dioxide ≥95.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 17524-05-9
MDL Number: MFCD00011506
Molecular Formula: C10H14MoO6
Molecular Weight: 326.18
Purity/Analysis Method: >95.0% (T)
Form: Crystal

SDS Certificates

Image Unavailable-CA80500-080

Cyclophosphamide monohydrate, Sigma-Aldrich®

Catalog Number: (CA80500-080)
Supplier: MilliporeSigma
Description: A widely used antineoplastic agent that also displays immunosuppressant activity

SDS Certificates


Image Unavailable-89150-876

DETA NONOate (NOC-18) ≥97% (by 1H-NMR)

Supplier: Enzo Life Sciences
Description: Nitric oxide (NO) donor.

Image Unavailable-CA8.08505.0100

Vanadyl(IV) acetylacetonate for synthesis, Sigma-Aldrich®

Catalog Number: (CA8.08505.0100)
Supplier: MilliporeSigma

SDS Certificates


Image Unavailable-TCT0249-025G

Titanyl(IV) acetylacetonate

Supplier: TCI America
Description: CAS Number: 14024-64-7
MDL Number: MFCD00013505
Molecular Formula: C10H14O5Ti
Molecular Weight: 262.08
Form: Crystal
Color: Slightly Pale Yellow
Melting point (°C): 200

SDS Certificates

Image Unavailable-CAAA40476-22

Bismuth(III) nitrate basic Bi₂O₃ 79%

Supplier: Thermo Scientific Chemicals
Description: Ceramic glazes and enamel fluxes

Certificates

Image Unavailable-CAAA89620-36

Potassium bis(oxalato)oxotitanate(IV) dihydrate

Supplier: Thermo Scientific Chemicals
Description: Applications: Mordant in dyeing, reagent
Soluble in water

Certificates

Image Unavailable-CAAA81119-18

Vanadyl(IV) acetylacetonate

Supplier: Thermo Scientific Chemicals
Description: As a catalyst, as a synthesis intermediate, as a paint dryer, and as a pigment

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
113 - 128 of 14,252
no targeter for Bottom