Print…

You Searched For: Benzo[b]thiophene-2-carboxylic+acid


66,701  results were found

Refine Results Sort by
SearchResultCount:"66701"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10423-846

Anti-PRODH Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10423-846)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-TCB3023-25G

Benzo[cd]indol-2(1H)-one ≥97.0% (by HPLC, total nitrogen)

Supplier: TCI America
Description: CAS Number: 130-00-7
MDL Number: MFCD00009748
Molecular Formula: C11H7NO
Molecular Weight: 169.18
Purity/Analysis Method: >97.0% (HPLC,N)
Form: Crystal
Melting point (°C): 181

SDS Certificates

Image Unavailable-10424-186

Anti-PRODH Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10424-186)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-76219-042

2,6-Dibromo-4,8-bis[(2-butyl-n-octyl)oxy]benzo[1,2-b:4,5-b']dithiophene ≥94.0% (by HPLC)

Catalog Number: (76219-042)
Supplier: TCI America
Description: 2,6-Dibromo-4,8-bis[(2-butyl-n-octyl)oxy]benzo[1,2-b:4,5-b']dithiophene, Purity: >94%(HPLC), CAS: 1336893-15-2, Molecular Formula: C34H52Br2O2S2, Molecular Weight: 716.72, Form: Clear, Pale yellow - Yellow, Size: 200MG
Image Unavailable-10093-960

Anti-RPS27A Rabbit Polyclonal Antibody

Catalog Number: (10093-960)
Supplier: Proteintech
Description: RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A)
Image Unavailable-TCM2580-1G

6-(Methoxycarbonyl)picolinic acid ≥97.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 7170-36-7
MDL Number: MFCD00806109
Molecular Formula: C8H7NO4
Molecular Weight: 181.15
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 153

SDS

Image Unavailable-10423-848

Anti-PRODH Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10423-848)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-TCE1147-1G

Ethyl 1-Cyclopropyl-6,7-difluoro-1,4-dihydro-8-methoxy-4-oxo-3-quinolinecarboxylate ≥98.0% (by GC)

Supplier: TCI America
Description: Ethyl 1-Cyclopropyl-6,7-difluoro-1,4-dihydro-8-methoxy-4-oxo-3-quinolinecarboxylate, Purity: >98%(GC), CAS No: 112811-71-9, Molecular Formula: C16H15F2NO4, Molecular Weight: 323.3, Form: Crystal- Powder, Size: 5G

SDS

Image Unavailable-10402-286

Anti-UGT2B4 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10402-286)
Supplier: Bioss
Description: The UDP-Glucuronosyltransferases (UGT) comprise a family of enzymes that detoxify and enhance the urinary excretion of a wide variety of xenobiotic and endogenous substrates by transferring glucuronic acid to sulfhydryl, hydroxyl, aromatic amino, or carboxylic acid groups. They have been subdivided into two families, UGT1 and UGT2, based on the evolutionary divergence of their genes. The enzymes of the UGT1A family play an important role in the metabolism of dietary constituents, phenols, and therapeutic drugs, and also the glucuronidation of bilirubin and iodothyronines. The enzymes of the UGT2B family are involved in the metabolism of bile acids, phenol derivatives, catecholestrogens and steroids. Although it is widely recognized that the liver is the major site of glucuronidation, it is now clear that UGT enzymes are also found in extra-hepatic tissues.
Image Unavailable-TCT2851-5G

2-Thiophenesulfonamide ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 6339-87-3
MDL Number: MFCD00185853
Molecular Formula: C4H5NO2S2
Molecular Weight: 163.21
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Color: Very Pale Yellow
Melting point (°C): 146

SDS Certificates

Image Unavailable-TCT1151-005G

2-(3-Thienyl)pyridine ≥95.0%

Catalog Number: (TCT1151-005G)
Supplier: TCI America
Description: CAS Number: 21298-55-5
MDL Number: MFCD00006214
Molecular Formula: C9H7NS
Molecular Weight: 161.22
Purity/Analysis Method: >95.0% (GC)
Form: Lump
Color: Very Pale Yellow
Freezing point (°C): 25

SDS


Image Unavailable-AAH64645-06

2-Bromodibenzothiophene 98%

Supplier: Thermo Scientific Chemicals
Description: 2-Bromodibenzothiophene, 98%

SDS Certificates

Image Unavailable-TCB4330-5G

N-tert-Butyl-2-thiophenesulfonamide ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 100342-30-1
MDL Number: MFCD02047252
Molecular Formula: C8H13NO2S2
Molecular Weight: 219.32
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 84

SDS

Image Unavailable-89158-172

DuP-697 ≥98% (by TLC)

Catalog Number: (89158-172)
Supplier: Enzo Life Sciences
Description: DuP-697 is a highly selective and irreversible inhibitor of cyclooxygenase-2 (COX-2)
Image Unavailable-103009-742

Tau Peptide (306-336) (Repeat 3 Domain)

Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-89151-254

RITA ≥98%

Catalog Number: (89151-254)
Supplier: Enzo Life Sciences
Description: Inhibitor of p53/HDM2 interaction
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,329 - 1,344 of 66,701
no targeter for Bottom