Print…

You Searched For: 6-Methoxysalicylaldehyde


68,160  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"68160"

Rate These Search Results

Product Image-97061-452

Sodium pyruvate ≥99%, Reagent Grade

Description: Sodium pyruvate ≥99%, Reagent Grade
Catalog Number: 97061-452
Supplier: VWR

SDS Certificates


Product Image-97062-744

MOPS-Na ≥99%, high purity

Description: MOPS-Na ≥99%, high purity
Catalog Number: 97062-744
Supplier: VWR

SDS Certificates


Image Unavailable-75794-420

Human Recombinant IL-27 non-lytic (from CHO Cells)

Description: Interleukin-27 (IL-27) is a heterodimeric group 2 receptor ligand molecule that belongs to the IL-6/IL-12 family of long type I cytokines. It is composed of EBI3 (EBV-induced gene 3), a 34 kDa glycoprotein that is related to the p40 subunit of IL-12 and IL-23, and p28, the cloned 28 kDa glycoprotein that is related to the p35 chain of IL-12. IL-27 is expressed by monocytes, endothelial cells and dendritic cells. IL-27 binds to and signals through a heterodimeric receptor complex composed of WSX1 (TCCR) and gp130. Evidence suggests IL-27 interacts only with WSX-1. IL-27 has both anti- and proinflammatory properties. As an antiinflammatory, IL-27 seems to induce a general negative feedback program that limits T and NK-T cell activity. At the onset of infection, IL-27 induces an IL-12 receptor on naie CD4+ T cells, making them susceptible to subsequent IL-12 activity (and possible Th1 development). Notably, IL-12 family cytokines are both induced and inhibited by bacterial products. Microbes promote IL-27 secretion through TLR4, and also block IL-27 production via C5a induction.
Catalog Number: 75794-420
Supplier: Prosci
Product Image-CAJTG680-9

Dibutylamine ≥99% (by GC), BAKER ANALYZED®, J.T.Baker®

Description: Dibutylamine ≥99% (by GC), BAKER ANALYZED®
Catalog Number: CAJTG680-9
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Certificates


Product Image-ABCA_AB115671-50UL

Anti-IL-27-A Rabbit Polyclonal Antibody

Description: Rabbit polyclonal to IL-27-A.
Catalog Number: ABCA_AB115671-50UL
Supplier: Abcam

New Product


Image Unavailable-TCD4674-1G

3,5-Dibromoisonicotinaldehyde ≥97.0% (by GC)

Description: 3,5-Dibromo-4-pyridinecarboxaldehyde, Purity: >97.0%(GC), CAS Number: 70201-42-2, MF: C6H3Br2NO, MW: 264.90, Synonym: 3,5-Dibromoisonicotinaldehyde, 3,5-Dibromo-4-formylpyridine, Form: Crystal-Powder, Solid, Color: Very pale yellow - Yellow, Size: 5G
Catalog Number: TCD4674-1G
Supplier: TCI America

SDS


Image Unavailable-102996-266

Human;Sheep;Rat PACAP (1-27), amide

Description: PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102996-266
Supplier: Anaspec Inc
Product Image-ABCA_AB229139-100U

Anti-IL-27-A Rabbit Polyclonal Antibody

Description: Rabbit polyclonal to IL-27-A.
Catalog Number: ABCA_AB229139-100U
Supplier: Abcam

New Product


Image Unavailable-CAAAAL12591-22

1-Ethynylcyclohexanol 99%

Description: 1-Ethynylcyclohexanol 99%
Catalog Number: CAAAAL12591-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA45556-A7

Trisodium citrate, anhydrous 99%

Description: Trisodium Citrate, Anhydrous, 99%
Catalog Number: CAAA45556-A7
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-103007-450

37,43Gap 27, Connexin Mimetic

Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103007-450
Supplier: Anaspec Inc
Image Unavailable-103008-116

[Lys(Ac)27]-Histone 3 (21-44)-GK,Biotin

Description: This peptide is Histone H3 amino acid residues 21 to 43. It is acetylated at lysine 27 with a C-terminal G linker followed by a biotinylated lysine. Acetylation of histone H3 at lysine 27 is associated with many active mammalian genes. In Arabidopsis thaliana, the acetylated histone at lysine 27 is nontransposable element gene-specific. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Ac)-SAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2974.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-116
Supplier: Anaspec Inc
Product Image-CAJTN152-5

HMDS (1,1,1,3,3,3-hexamethyldisilazane) ≥99%, BAKER ANALYZED®, J.T.Baker®

Description: HMDS (1,1,1,3,3,3-hexamethyldisilazane) ≥99%, BAKER ANALYZED®
Catalog Number: CAJTN152-5
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Certificates


Product Image-ABCA_AB62501-100UG

Anti-IL-27-A Rabbit Polyclonal Antibody

Description: Rabbit polyclonal to IL-27-A.
Catalog Number: ABCA_AB62501-100UG
Supplier: Abcam

New Product


Product Image-ABCA_AB118910-50UG

Anti-IL-27-A Rabbit Polyclonal Antibody

Description: Rabbit polyclonal to IL-27-A.
Catalog Number: ABCA_AB118910-50UG
Supplier: Abcam

New Product


Image Unavailable-103007-448

40Gap 27, Connexin Mimetic

Description: This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40), designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered, 40Gap27 attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.
Sequence:SRPTEKNVFIV
MW:1289.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103007-448
Supplier: Anaspec Inc
353 - 368 of 68,160