Print…

You Searched For: 9,9-Dimethylfluorene-2-boronic+acid+pinacol+ester


3,438  results were found

Refine Results Sort by
SearchResultCount:"3438"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CA95020-156

Nutrient Gelatin Dehydrated Culture Media, HiMedia

Catalog Number: (CA95020-156)
Supplier: HiMedia
Description: For the detection of gelatin liquefaction by proteolytic microorganisms.

SDS Certificates


Image Unavailable-76098-696

Anti-Tumstatin Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76098-696)
Supplier: Bioss
Description: COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.
Image Unavailable-10792-362

Anti-CAMK4 Rabbit Polyclonal Antibody

Catalog Number: (10792-362)
Supplier: Genetex
Description: Rabbit polyclonal antibody to CAMK4
Image Unavailable-10325-034

Anti-COL4A3 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10325-034)
Supplier: Bioss
Description: COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.
Image Unavailable-10338-382

Anti-COL4A3 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10338-382)
Supplier: Bioss
Description: COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.
Product Image-76407-972

Cloth Tapes, DUKAL™ Corporation

Supplier: Dukal
Description: The perfect amount of tape for securing dressings, I.V. sites, or tubing.

Certificates

Product Image-10111-238

Anti-MMP2 Rabbit Polyclonal Antibody

Catalog Number: (10111-238)
Supplier: Prosci
Description: MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Image Unavailable-10325-032

Anti-COL4A3 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10325-032)
Supplier: Bioss
Description: COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.
Image Unavailable-10783-704

Accessories for PrimaCell™, Mouse Lymphatic Fibroblast Cell Culture Kit, CHI Scientific

Catalog Number: (10783-704)
Supplier: CHI Scientific
Description: Stability/Storage: The reagents contained in this system are packed in dry ice or gel ice packs for shipping but the kit should be used immediately or the package should be stored at -20°C upon arrival. The reagents contained in this kit are stable and effective for up to 6 months at -20°C.
Image Unavailable-10169-232

Anti-CAMK4 Mouse Monoclonal Antibody [clone: 8C5B8]

Catalog Number: (10169-232)
Supplier: Genetex
Description: Mouse Monoclonal Antibody [8C5B8] to CAMK4
Image Unavailable-76236-750

Human MMP-9 ELISA Kit, Rockland Immunochemicals

Catalog Number: (76236-750)
Supplier: Rockland Immunochemical
Description: Human MMP-9 AccuSignal ELISA Kit
Product Image-76262-770

Anti-COL3A1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: (76262-770)
Supplier: Rockland Immunochemical
Description: In muscle tissue, collagen serves as a major component of the endomysium. Collagen constitutes one to two percent of muscle tissue, and accounts for 6% of the weight of strong, tendinous muscles. A collagen may be defined as a protein containing sizable domain(s) of triple-helical conformation. Type IV collagen is a major macromolecular constituent of basement membranes and can be readily isolated from basement-membrane-rich tissues or highly vascularized tissues such as the placental villi. This collagen appears to be largely restricted to structures identifiable as basement membranes. In contrast, type VI collagen appears to be prevalent in several tissues even though it has been isolated largely from placental villi preparations. The extent to which type VII and VIII collagens are distributed is not known.
Image Unavailable-C-3900.0005BA

Z-Ile-Glu(OtBu)-Ala-Leu-Aldehyde

Catalog Number: (C-3900.0005BA)
Supplier: Bachem Americas
Description: See also Leupeptin (N-1000) and MG-132 (Calpain Inhibitor IV, N-1635).
Image Unavailable-103008-696

Human GLP-1(9-36), amide

Catalog Number: (103008-696)
Supplier: Anaspec Inc
Description: GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-89352-372

Anti-Influenza A NUCLEO Mouse Monoclonal Antibody

Catalog Number: (89352-372)
Supplier: Genetex
Description: This antibody is directed against influenza virus type A, (nucleoproteid).
Image Unavailable-H-4012.0001BA

Bovine;Guinea pig;Human;Mouse;Pig;Rat GLP-1 (9-36) Amide Trifluoroacetate

Supplier: Bachem Americas
Description: For the long-acting GLP-1 analog liraglutide see H-6724.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,265 - 1,280 of 3,438
no targeter for Bottom