Print…

You Searched For: EXCELTA+CORPORATION


101,024  results were found

Refine Results Sort by
SearchResultCount:"101024"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-756

Histone H3 (1-21), FAM (Carboxyfluorescein)

Catalog Number: (103007-756)
Supplier: Anaspec Inc
Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a FAM (Abs/Em = 494/521 nm) labeled lysine.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2854.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-432

Human ACTH (18-39)

Catalog Number: (102998-432)
Supplier: Anaspec Inc
Description: This ACTH (18-39) fragment is known as the Corticotropin-like Intermediate Lobe Peptide. It stimulates insulin secretion as well as amylase and protein secretion in a dose-dependent manner similar to those of secretin and carbamylcholine.
Sequence: RPVKVYPNGAEDESAEAFPLEF
MW: 2465.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103009-380

Histone H3 (69-89)-K, Biotin

Catalog Number: (103009-380)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (69-89) biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDFKTDLRFQSSAV-K(Biotin)
MW:2834.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-536

Human Leptin (93-105)

Catalog Number: (103007-536)
Supplier: Anaspec Inc
Description: This is amino acids 93 to 105 fragment of human leptin (anti-obesity protein). Leptin is a 167-amino acid plasma protein that is synthesized in adipose tissue and acts as a blood-borne hormone responsible for weight maintenance.
Sequence: NVIQISNDLENLR
MW: 1527.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103010-018

Human Protease Activated Receptor 1

Catalog Number: (103010-018)
Supplier: Anaspec Inc
Description: This peptide is a PAR-1 antagonist which inhibited SFLLRNP induced platelet aggregation with an IC50 of 115 uM. Antagonists specific for the thrombin receptor can be promising compounds for treatment of thrombosis.
Sequence: S - F(para - Fluoro) - Aad - LRNP - NH2
MW: 892.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103005-984

Caspase 1 Inhibitor II

Catalog Number: (103005-984)
Supplier: Anaspec Inc
Description: Caspase 1 Inhibitor II is an irreversible caspase-1, (IL-1β-converting enzyme, ICE) inhibitor. It is neuroprotective, rescuing neuronal cell cultures from cell death. It alco reduces lipopolysaccharide-lethality in animals.
Sequence:Ac-YVAD-CMK
MW:541 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-878

Bak BH3

Catalog Number: (103006-878)
Supplier: Anaspec Inc
Description: This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102971-776

Apelin 12

Catalog Number: (102971-776)
Supplier: Anaspec Inc
Description: Apelin-12, one of the most potent apelin peptides, lowers blood pressure via a nitric oxide-dependent mechanism. It is also involved in the central control of feeding by stimulating cholecystokinin (CCK) secretion.
Sequence:RPRLSHKGPMPF
MW:1422.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103003-004

Saccharomyces cerevisiae alpha-Mating Factor Pheromone

Catalog Number: (103003-004)
Supplier: Anaspec Inc
Description: This tridecapeptide, an alpha-factor pheromone of Saccharomyces cerevisiae, induces conjugation in yeast by binding to Ste2p. Its cognate GPCR activates a G protein signal pathway that highly conserves with mammalian signaling pathways.
Sequence:WHWLQLKPGQPMY
MW:1684 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-082

Human IGRP Catalytic Subunit-related Protein (206-214)

Catalog Number: (103008-082)
Supplier: Anaspec Inc
Description: This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.
Sequence: VYLKTNVFL
MW: 1096.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103008-442

Ryanodine receptor

Catalog Number: (103008-442)
Supplier: Anaspec Inc
Description: This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103005-422

Human [Pyr11]-beta-Amyloid (11-42)

Supplier: Anaspec Inc
Description: This is a pyroglutamic acid modified beta-amyloid 11-42 peptide. Pyroglutamic acid modified isoforms form the major isoforms with up to 20% of the total beta-amyloid species.
Sequence: Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3317.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-102996-882

PKC (Protein Kinase C) Substrate

Catalog Number: (102996-882)
Supplier: Anaspec Inc
Description: The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-832

Noxa BH3, Peptide 1

Catalog Number: (103007-832)
Supplier: Anaspec Inc
Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-478

Histone H3 (1-50)-GGK, Biotin

Catalog Number: (103009-478)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
MW:5809.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-764

Staphylococcus Staphylococcal Enterotoxin B Domain (SEB) (144-153)

Catalog Number: (103007-764)
Supplier: Anaspec Inc
Description: This peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172. This peptide sequence is highly conserved. It has been shown to inhibit transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1.
Sequence:KKKVTAQELD
MW:1159.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
849 - 864 of 101,024
no targeter for Bottom