You Searched For: 3,4-Dibromothiophene


2,037  results were found

SearchResultCount:"2037"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Scientific Chemicals
Description: Crystalline
Catalog Number: (75834-694)
Supplier: Restek
Description: Standard Surrogate (3,4-Dinitrotoluene) 8095, CAS no: 610-39-9, Concentration: 1,000 ug/mL in methanol, Shelf Life: 6 Months, Storage: 10 deg C or colder, Volume: 1 mL/ampule


Catalog Number: (77982-947)
Supplier: LGC Standards
Description: TRC 5-(3,4-dihydroxyphenyl)pentanoic Acid

New Product


Catalog Number: (76699-844)
Supplier: AFG Bioscience
Description: Human Cluster of Differentiation 34(CD34) ELISA Kit


Catalog Number: (76699-510)
Supplier: AFG Bioscience
Description: Mouse Cluster of Differentiation 34(CD34) ELISA Kit


Catalog Number: (77982-680)
Supplier: LGC Standards
Description: TRC 3,4-Dihydro Ivermectin (Mixture of Diastereomers)

New Product


Supplier: TCI America
Description: 6-Fluorochroman-2-carboxylic Acid, Purity: >98.0%(GC)(T), CAS Number: 99199-60-7, Molecular Formula: C10H9FO3, Molecular Weight: 196.18, Synonyms: 6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-carboxylic Acid, Size: 5G

Supplier: TCI America
Description: Tert-Butyl 6-Oxa-3-Azabicyclo[3.1.0]Hexane-3-Carboxylate, Purity: >95.0%(GC), Cas no: 114214-49-2, Molecular formula : C9H15NO3, Molecular weight : 185.22, Synonyms: 1-Boc-3,4-epoxypyrrolidine, Size: 5G

Catalog Number: (77976-558)
Supplier: LGC Standards
Description: TRC N-Acetyl-S-(3,4-dimethylbenzene)-L-cysteine-d3

New Product


Catalog Number: (CA80055-494)
Supplier: MilliporeSigma
Description: A derivative of papaverine that blocks Ca2+ channels (principally the L-type) in smooth and cardiac muscle cells

Catalog Number: (77978-704)
Supplier: LGC Standards
Description: TRC Trans-3,4-Bis[[(methylsulfonyl)thio]methyl]-2,2,5,5-tetramethylpyrrolidin-1-yloxyl Radical

New Product


Catalog Number: (77982-395)
Supplier: LGC Standards
Description: TRC (4R)-(3’,4’-Dichlorophenyl)-3,4-dihydro-2H-naphthalen-1-one

New Product


Supplier: TCI America
Description: CAS Number: 1762-34-1
MDL Number: MFCD01740554
Molecular Formula: C12H12N2
Molecular Weight: 184.24
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 115
Supplier: Abcam
Description: Rabbit monoclonal [EPR19089-34] to MEF2A + MEF2C.

New Product

Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (77520-784)
Supplier: AFG Bioscience
Description: Mouse IL34 (Interleukin 34) ELISA Kit


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
721 - 736 of 2,037
no targeter for Bottom