You Searched For: 3,8-Diamino-6-phenylphenanthridine


3,948  results were found

SearchResultCount:"3948"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Abcam
Description: Rabbit monoclonal [EPR1878(2)] to beta Amyloid 1-38.

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR24447-38] to PIM1 - BSA and Azide free (Capture).

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR22953-38] to CHD4 - ChIP Grade.

New Product

Catalog Number: (76951-450)
Supplier: ANTIBODIES.COM LLC
Description: Anti-IPO-38 Mouse Monoclonal Antibody [clone: SPM260]


Supplier: Abcam
Description: Rabbit monoclonal [EPR22626-38] to Arg2 - BSA and Azide free.

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR27539-38] to NQO1 - BSA and Azide free (Detector).

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR26648-38] to CBS - BSA and Azide free (Detector).

New Product

Catalog Number: (H-1316.0500BA)
Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).


Catalog Number: (102996-412)
Supplier: Anaspec Inc
Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (76953-180)
Supplier: ANTIBODIES.COM LLC
Description: Anti-IPO-38 Mouse Monoclonal Antibody [clone: SPM515]


Catalog Number: (CA200-301-278)
Supplier: Rockland Immunochemical
Description: Anti-IPO-38 is suitable for ELISA,  immunoprecipitation, western blotting and immunochemistry (frozen and formalin/paraffin). The antibody is reported to recognize a nuclear antigen that is present in the cytoplasm and nuclei of proliferating cells.


Supplier: Abcam
Description: Rabbit monoclonal [EPR22953-38] to CHD4 - ChIP Grade – BSA and Azide free.

New Product

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00011125
Catalog Number: (89275-316)
Supplier: Genetex
Description: Mouse Monoclonal antibody to Mycobacterium Tuberculosis 38 kDa Antigen Clone: BGN/1209/3875 Species Reactivity: Bacteria Tested Applications: ELISA WB Pkg Size: 200 ug


Supplier: Abcam
Description: Rabbit monoclonal [EPR1878(2)] to beta Amyloid 1-38 - BSA and Azide free.

New Product

Catalog Number: (76950-664)
Supplier: ANTIBODIES.COM LLC
Description: Anti-IPO-38 Mouse Monoclonal Antibody [clone: SPM515]


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
113 - 128 of 3,948
no targeter for Bottom