You Searched For: 3,6-Dibromocarbazole


4,461  results were found

SearchResultCount:"4461"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103008-276)
Supplier: Anaspec Inc
Description: This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: VWR International
Description: Interleukin 36 gamma (IL-36 ɣ) is a member of the interleukin 1 (IL-1) cytokine family and protects against pathogens in the skin, lung, and stomach epithelial barriers. IL-36 ɣ binds the interleukin-1 receptor accessory protein (IL-1RAcP) and the orphan IL-1R-related protein 2 (IL-1Rrp2) receptors to activate NF-kB and MAP kinase signaling pathways, resulting in the induced production of inflammatory cytokines and chemokines.

New Product

Catalog Number: (103009-532)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:APRKQLATKAARKSAPATGGVK-GGK(biotin)
MW:2676.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (ABCA_AB111599-50UL)
Supplier: Abcam
Description: Rabbit polyclonal to Keratin 36.

New Product


Catalog Number: (102996-380)
Supplier: Anaspec Inc
Description: This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3524 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Catalog Number: (102868-708)
Supplier: R&D Systems
Description: The Recombinant Human IL-36 gamma/IL-1F9 (aa 18-169) Protein from R&D Systems is derived from E. coli. The Recombinant Human IL-36 gamma/IL-1F9 (aa 18-169) Protein has been validated for the following applications: Bioactivity.


Catalog Number: (102867-688)
Supplier: R&D Systems
Description: The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein has been validated for the following applications: Bioactivity.


Supplier: Thermo Scientific Chemicals
Description: Hydrochloric acid 36% (w/w) in aqueous solution
Supplier: Avantor
Description: A successful lockout program begins with the right devices stored in the right places

Catalog Number: (103003-044)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Molecular Weight: 4017.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (CA101447-570)
Supplier: New England Biolabs (NEB)
Description: α1-3, 6 Galactosidase is a highly specific exoglycosidase that catalyzes the hydrolysis of α1-3, 6 linked D-galactopyranosyl residues from oligosaccharides.


Catalog Number: (76219-628)
Supplier: TCI America
Description: 2,5-Bis(2-octyldodecyl)-3,6-bis[5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)thiophen-2-yl]pyrrolo[3,4-c]pyrrole-1,4(2H,5H)-dione, Purity: >98.0%(HPLC), Molecular formula: C66H110B2N2O6S2, Molecular weight: 1113.35, Form: Crystal- Powder, Pale red - Red, Size: 200MG


Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 36 gamma (IL-36 ɣ) is a member of the interleukin 1 (IL-1) cytokine family and protects against pathogens in the skin, lung, and stomach epithelial barriers. IL-36 ɣ binds the interleukin-1 receptor accessory protein (IL-1RAcP) and the orphan IL-1R-related protein 2 (IL-1Rrp2) receptors to activate NF-kB and MAP kinase signaling pathways, resulting in the induced production of inflammatory cytokines and chemokines.

Catalog Number: (102867-686)
Supplier: R&D Systems
Description: The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein has been validated for the following applications: Bioactivity.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
113 - 128 of 4,461
no targeter for Bottom