You Searched For: 3,5-Xylylacetonitrile


6,134  results were found

SearchResultCount:"6134"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: PD 173074, Purity: >95.0%(HPLC), CAS Number: 219580-11-7, Molecular Formula: C28H41N7O3, Molecular Weight: 523.68, Synonyms: 1-(tert-Butyl)-3-[7-[[4-(diethylamino)butyl]amino]-3-(3,5-dimethoxyphenyl)pyrido[2,3-d]pyrimidin-2-yl]urea, Size: 50MG

Catalog Number: (CA10789-388)
Supplier: HARDY DIAGNOSTICS CA
Description: This 25×35", Biohazard bag is for the collection of biohazard waste.


Catalog Number: (103301-878)
Supplier: Electron Microscopy Sciences
Description: Swiss made precision tweezers from Dumont.


Catalog Number: (89062-306)
Supplier: Ace Glass
Description: Used with aluminum packing box

Small Business Enterprise Product available on GSA Advantage®


Supplier: Spectrum Laboratories
Description: Biologically inert and ultra-pure, Biotech Cellulose Ester (CE) Membrane offers the largest range of concise MWCO's (100 to 1000000 Daltons) for desalting, isolating ionic species and macromolecular purifications.

Small Business Enterprise

Catalog Number: (103005-970)
Supplier: Anaspec Inc
Description: A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (89520-514)
Supplier: Abgent
Description: Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Human, Gene ID: 6129, Target/Specificity: This RPL7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human RPL7.


Catalog Number: (10057-580)
Supplier: IKA Works


Supplier: Kemtech America
Description: Traps feature 35/20 spherical joints for added flexibility.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier: TCI America
Description: Tyrphostin AG 494, Purity: >98.0%(HPLC)(N), Cas number: 133550-35-3, Molecular Formula: C16H12N2O3, Molecular Weight: 280.28, Appearance: Pale yellow - Deep yellow green solid crystal powder, Synonyms: (E)-2-Cyano-3-(3,4-dihydroxyphenyl)-N-phenylacrylamide, Size: 20MG

SDS

Catalog Number: (89518-054)
Supplier: Abgent
Description: Polyclonal antibody, Isotype: Rabbit Ig, Species Reactivity: Human , Gene ID: 2012 , Target/Specificity: generated from rabbits immunized with a KLH conjugated synthetic peptide between 35-63 amino acids from the N-terminal region of human EMP1


Catalog Number: (89518-064)
Supplier: Abgent
Description: Polyclonal antibody, Isotype: Rabbit Ig, Species Reactivity: Human, Mouse , Gene ID: 10253 , Target/Specificity: generated from rabbits immunized with a KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human SPRY2


Supplier: TAPECASE LTD. TE
Description: VHB™ Tapes are fast and easy-to-use, with a permanent bonding method to provide high strength and long-term durability.

Supplier: Ace Glass
Description: This straight connecting adapter comes with either standard taper or spherical joints at both the top and the bottom.

Small Business Enterprise Product available on GSA Advantage®

Supplier: Corning
Description: These filtration apparatus and components are designed for HPLC mobile phase filtration, analysis of particulate or bacterial contamination and general laboratory microfiltration. Units have coarse porosity frits, and accommodate 47 mm filters.
Supplier: TrippNT
Description: TrippNT's Core DX with sliding door offers locking organization and storage for controled environments.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,601 - 1,616 of 6,134
no targeter for Bottom