You Searched For: 3,4-Diaminoanisole


4,474  results were found

SearchResultCount:"4474"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (TCA2309-5G)
Supplier: TCI America
Description: CAS Number: 84539-34-4
MDL Number: MFCD00234048
Molecular Formula: C5H4Br2N2
Molecular Weight: 251.91
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 168

SDS


Catalog Number: (TCF0542-5G)
Supplier: TCI America
Description: CAS Number: 80154-34-3
Molecular Formula: C13H16O7
Molecular Weight: 284.26
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 190

SDS


Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).

Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Abcam
Description: Rabbit monoclonal [EPR16259-34] to Cubilin - BSA and Azide free.

New Product

Supplier: TCI America
Description: 5-Chloro-4-fluoro-2-nitroaniline, CAS Number: 104222-34-6, Purity: 98.0% Pure, Molecular Formula: C6H4ClFN2O2, Molecular Weight: 190.56 g/mol, Physical Form: Solid, Size: 1G

SDS

Catalog Number: (TCD1878-100G)
Supplier: TCI America
Description: CAS Number: 1131-62-0
MDL Number: MFCD00008737
Molecular Formula: C10H12O3
Molecular Weight: 180.20
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 161
Melting point (°C): 49
Flash Point (°C): 110

Supplier: Abcam
Description: Rabbit monoclonal [EPR26993-34] to Plectin - BSA and Azide free (Capture).

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR25980-34] to CLSTN1 - BSA and Azide free (Capture).

New Product

Supplier: Thermo Scientific Chemicals
Supplier: TCI America
Description: CAS Number: 6627-34-5
MDL Number: MFCD00025157
Molecular Formula: C6H4Cl2N2O2
Molecular Weight: 207.01
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 155
Supplier: Abcam
Description: Rabbit monoclonal [EPR22890-34] to ICAM3 - BSA and Azide free (Detector).

New Product

Catalog Number: (89152-554)
Supplier: Enzo Life Sciences
Description: AMPA receptor activator


Supplier: MilliporeSigma
Description: Cas Number 111-34-2, Stabilised With 100 Ppm Koh For Synthesis

SDS

Catalog Number: (CAAAAL01627-06)
Supplier: Thermo Scientific Chemicals
Description: 2-Chloro-4,5-xylenol 98%

Catalog Number: (89044-788)
Supplier: DWK Life Sciences (KIMBLE)
Description: threaded, 34 mm OD

Small Business Enterprise


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
769 - 784 of 4,474
no targeter for Bottom