Print…

You Searched For: 3,4-Diacetoxybenzaldehyde


4,468  results were found

Refine Results Sort by
SearchResultCount:"4468"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAAL06258-14

Piperonylacetone 98%

Supplier: Thermo Scientific Chemicals
Description: Piperonylacetone 98%

Certificates

Image Unavailable-89278-362

Anti-CD1A Mouse Monoclonal Antibody (FITC (Fluorescein Isothiocyanate)) [clone: NA1/34-HLK]

Catalog Number: (89278-362)
Supplier: Genetex
Description: Mouse monoclonal antibody [NA1/34-HLK] to CD1a
Image Unavailable-TCB1923-5G

4,4'-Bis(diethylphosphonomethyl)biphenyl ≥95.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 17919-34-5
MDL Number: MFCD01321144
Molecular Formula: C22H32O6P2
Molecular Weight: 454.44
Purity/Analysis Method: >95.0% (HPLC)
Form: Crystal

SDS

Product Image-97061-408

Adenosine free base

Catalog Number: (97061-408)
Supplier: VWR
Description: A purine nucleoside essential for a variety of metabolic processes including energy transfer, signal transduction and mediation of inflammatory pathways.

SDS Certificates


Image Unavailable-H-3092.0500BA

Human (Tyr¹)-pTH (1-34) Trifluoroacetate

Catalog Number: (H-3092.0500BA)
Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).
Image Unavailable-TCC0442-500ML

Methyl cyanoacetate ≥99.0%

Supplier: TCI America
Description: CAS Number: 105-34-0
MDL Number: MFCD00001939
Molecular Formula: C4H5NO2
Molecular Weight: 99.09
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 205
Flash Point (°C): 105
Specific Gravity (20/20): 1.13

SDS Certificates

Image Unavailable-75841-424

Anti-MHCI Mouse Monoclonal Antibody (FITC (Fluorescein Isothiocyanate)) [clone: 34-1-2S]

Catalog Number: (75841-424)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The 34-1-2S monoclonal antibody specifically reacts with the mouse H-2k/H2D MHC class I alloantigens, which are involved in antigen presentation to T cells. The 34-1-2S antibody cross-reacts with the b, p, q, r, and s haplotypes.
Product Image-89152-494

Verapamil hydrochloride ≥99%

Supplier: Enzo Life Sciences
Description: Blocks slow voltage-sensitive L-type Ca2+ channels. Adrenergic antagonist. Inhibits platelet-activating factor and PMA-stimulated prostaglandin production in Kupffer cells. Induces apoptosis. In vitro resistance modifier in drug resistant human tumor cell lines.

Image Unavailable-89028-150

Replacement Attachments for Vortex 4 Basic and Digital Vortexers, IKA® Works

Catalog Number: (89028-150)
Supplier: IKA Works
Description: Shaker, Vortex Mixer, MS 3.4 Microtiter Plate Attachment
Image Unavailable-76219-892

Flt-3 inhibitor ≥98.0% (by HPLC)

Supplier: TCI America
Description: 2-(3,4-Dimethoxybenzamido)-4,5,6,7-tetrahydrobenzo[b]thiophene-3-carboxamide, Purity: >98%(HPLC), CAS: 301305-73-7, MF: C18H20N2O4S, MW: 360.43, Synonyms: Flt-3 Inhibitor, TCS 359, Form: Crystal-Powder, Size: 100MG

Image Unavailable-89264-956

Anti-SP Rat Monoclonal Antibody [clone: NC1/34]

Catalog Number: (89264-956)
Supplier: Genetex
Description: Rat monoclonal antibody [NC1/34] to Substance P
Image Unavailable-TCD3516-5G

2,3-Dimethylphenylboronic acid (contains varying amounts of Anhydride)

Catalog Number: (TCD3516-5G)
Supplier: TCI America
Description: CAS Number: 183158-34-1
MDL Number: MFCD01863524
Molecular Formula: C8H11BO2
Molecular Weight: 149.98
Form: Crystal
Color: White
Melting point (°C): 175

SDS Certificates


Image Unavailable-TCB1854-005G

4-Bromo-3-nitrotoluene ≥96.0%

Supplier: TCI America
Description: CAS Number: 5326-34-1
MDL Number: MFCD00024180
Molecular Formula: C7H6BrNO2
Molecular Weight: 216.03
Purity/Analysis Method: >96.0% (GC)
Form: Crystal
Boiling point (°C): 152
Flash Point (°C): 110
Freezing point (°C): 31

SDS

Image Unavailable-103006-992

Human Beta-Amyloid (1-34)

Catalog Number: (103006-992)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-89161-326

Cilostazol ≥98%

Supplier: Enzo Life Sciences
Description: PDE inhibitor

Image Unavailable-TCB1926-001G

9-(Bromomethyl)acridine ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: [for HPLC Labeling]
CAS Number: 1556-34-9
MDL Number: MFCD01321146
Molecular Formula: C14H10BrN
Molecular Weight: 272.15
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 165

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
529 - 544 of 4,468
no targeter for Bottom