Print…

You Searched For: 1,4-Diethynylbenzene


3  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"3"

Rate These Search Results

Product Image-10749-048

SLC1A7 antibody

Description: SLC1A7 antibody, polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Isotype: IgG, Immunogen: SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7, Applications:ELISA, IF, IHC, WB
Catalog Number: 10749-048
Supplier: Prosci
Image Unavailable-75790-154

Calumenin Recombinant Protein 50 ug

Description: Calumenin Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Lys20-Phe315, Fusion Tag: C-6 His tag, Purity: Greater than 95% (SDS-PAGE), Physical state: Lyophilized, Synonyms: IEF SSP 9302, CALU, Application: Biological assay, Size: 50 ug
Catalog Number: 75790-154
Supplier: Prosci
Product Image-CARL200101238S

GS Antibody 25uL

Description: Glutamine Synthetase Antibody Detects Microbial Gs. Glutamine Synthetase (Gs)Is An Enzyme That Plays An Essential Role In The Metabolism Of Nitrogen By Catalyzing The Condensation Of Glutamate And Ammonia To Form Glutamine: Glutamate + Atp + Nh3 Glutamine + Adp + Phosphate. Goat
Catalog Number: CARL200101238S
Supplier: Rockland Immunochemical
Product Image-10094-740

Anti-SLC25A13

Description: Anti-SLC25A13 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, C-term-340 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10094-740
Supplier: Proteintech
Product Image-10209-754

GCLC antibody

Description: GCLC polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GCLC(7-24aa GSPLSWEETKRHADHVRR), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10209-754
Supplier: Boster Biological Technology
Image Unavailable-TCG0061-100G

DL-Pyroglutamic Acid 100G

Description: DL-Pyroglutamic Acid, Purity: >99.0%(T), CAS No: 149-87-1, MF: C5H7NO3, MW: 129.12, Synonym: DL-Glutamic Acid Lactam, H-DL-Pyr-OH, 5-Oxopyrrolidine-2-carboxylic Acid, 2-Pyrrolidone-5-carboxylic Acid, Physical state: Solid, Form: Crystal- Powder, Colour: White, Size: 100G
Catalog Number: TCG0061-100G
Supplier: TCI America

SDS Certificates


Image Unavailable-10447-374

CHRNA3 Antibody

Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-374
Supplier: Bioss
Image Unavailable-CAPIPA5-18931

GRIA4 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (KKLDQREYPGSETP) corresponding to the internal amino acids of GRIA4
Catalog Number: CAPIPA5-18931
Supplier: Thermo Scientific
Image Unavailable-75790-070

CRELD2 Recombinant Protein 50 ug

Description: CRELD2 Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Ala25-Leu321, Fusion Tag: C-6 His tag, Purity: Greater than 95% (SDS-PAGE), Synonyms: Cysteine-Rich With EGF-Like Domain Protein 2, CRELD2, Application: Biological assay, Size: 50 ug
Catalog Number: 75790-070
Supplier: Prosci
Product Image-10102-784

GOT2 antibody

Description: Polyclonal, Host: Rabbit, Species reactivity: human mouse rat , Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human GOT2. Purified by peptide affinity chromatography method. Application: ELISA Western blot 50ug
Catalog Number: 10102-784
Supplier: Prosci
Image Unavailable-10447-376

CHRNA3 Antibody

Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-376
Supplier: Bioss
Image Unavailable-103007-114

[Gly22] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc
Image Unavailable-TCG0065-005G

L-gamma-Glutamyl-p-nitroanilide Monohydrate, Min 98.0% (HPLC)(T)

Description: 5G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-005G
Supplier: TCI America

SDS


Image Unavailable-TCG0065-001G

L-gamma-Glutamyl-p-nitroanilide Monohydrate, Min 98.0% (HPLC)(T)

Description: 1G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-001G
Supplier: TCI America

SDS Certificates


Image Unavailable-77438-046

ANTIBODY KLB POLYCLONAL 100UL

Catalog Number: 77438-046
Supplier: Bioss
Image Unavailable-10087-302

Anti-GAD2

Description: Anti-GAD2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Peptide, Peptide with Sequence CLRTLEDNEERMSRLSKVA, Format:Antigen affinity purification, Application: ELISA, WB, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10087-302
Supplier: Proteintech
145 - 3 of 3