You Searched For: Ethylboronic acid

Catalog Number: (10399-084)

Supplier: Bioss

Description: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.

Catalog Number: (102996-410)

Supplier: Anaspec Inc

Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Thermo Scientific Chemicals

Description: MDL: MFCD00011286 Notes: May contain up to 0.15% Calcium

Certificates

Catalog Number: (10088-198)

Supplier: Proteintech

Description: The intermediate conductance calcium-activated potassium channel KCNN4, also known as KCa3.1, IK1, or SK4, is a member of the potassium channel KCNN family. KCNN4 is expressed in T cells, mast cells, macrophages, erythrocytes, vascular smooth muscle cells, airway smooth muscle cells, intestinal and airway epithelial cells . Functionally, KCNN4 plays a key role in calcium-dependent cell functions, such as proliferation, activation, and migration, in a broad range of cell types .

Catalog Number: (76098-948)

Supplier: Bioss

Description: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium.

Catalog Number: (10665-568)

Supplier: Bioss

Description: The EF-hand domain is a twelve amino acid loop motif that is commonly found in proteins that participate in calcium-binding events within the cell. EF-hand domains generally exist in a pair that, together, form a stable four-helix bundle that enables the binding of calcium ions. EF-HA1 (EF-hand domain family, member A1) is a 434 amino acid protein that contains four EF-hand domains, suggesting a role in calcium-mediated events throughout the cell. The gene encoding EF-HA1 maps to human chromosome 13, which houses over 400 genes, such as BRCA2 and RB1, and comprises nearly 4% of the human genome. Trisomy 13, also known as Patau syndrome, is deadly and the few who survive past one year suffer from permanent neurologic defects, difficulty eating and vulnerability to serious respiratory infections.

Catalog Number: (89165-942)

Supplier: Enzo Life Sciences

Description: Calcium dye

Supplier: Bachem Americas

Description: F2L is an acetylated peptide corresponding to an N-terminal fragment of the human heme-binding protein. Ac-MLGMIKNSLFGSVETWPWQVL acts specifically through the FPR-like receptor (FPRL) 2 promoting calcium mobilization and chemotaxis in dendritic cells and monocytes. In neutrophils, F2L inhibited FPR and FPRL1-mediated signaling.

SDS

Supplier: Mortech Manufacturing

Description: All positive control slides are on Mopec IHC Enhanced Hydrophilic Adhesive Slides using Formalin Fixed Paraffin Embedded (FFPE) human tissue.

Catalog Number: (76109-674)

Supplier: Bioss

Description: The EF-hand domain is a twelve amino acid loop motif that is commonly found in proteins that participate in calcium-binding events within the cell. EF-hand domains generally exist in a pair that, together, form a stable four-helix bundle that enables the binding of calcium ions. EF-HA1 (EF-hand domain family, member A1) is a 434 amino acid protein that contains four EF-hand domains, suggesting a role in calcium-mediated events throughout the cell. The gene encoding EF-HA1 maps to human chromosome 13, which houses over 400 genes, such as BRCA2 and RB1, and comprises nearly 4% of the human genome. Trisomy 13, also known as Patau syndrome, is deadly and the few who survive past one year suffer from permanent neurologic defects, difficulty eating and vulnerability to serious respiratory infections.

Catalog Number: (10390-104)

Supplier: Bioss

Description: This is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence (By similarity).

Catalog Number: (77439-004)

Supplier: Bioss

Description: Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (By similarity). Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.

Catalog Number: (10101-796)

Supplier: Prosci

Description: KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.

Catalog Number: (89296-456)

Supplier: Genetex

Description: Goat polyclonal antibody to Orai1

Catalog Number: (10399-464)

Supplier: Bioss

Description: The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin A7 is a member of the annexin family of calcium dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage sensitive calcium channel activity, ion selectivity and membrane fusion.

Catalog Number: (10405-954)

Supplier: Bioss

Description: The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin A7 is a member of the annexin family of calcium dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage sensitive calcium channel activity, ion selectivity and membrane fusion.