Print…

You Searched For: 2-Fluoro-L-phenylalanine


1,580  results were found

Refine Results Sort by
SearchResultCount:"1580"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-AAH63073-06

Fmoc-O-methyl-D-tyrosine 98%

Supplier: Thermo Scientific Chemicals
Description: N-Fmoc-O-methyl-D-tyrosine, 98%

SDS Certificates

Image Unavailable-77440-680

Anti-DNAJB12 Rabbit Polyclonal Antibody

Catalog Number: (77440-680)
Supplier: Bioss
Description: DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 (PubMed 11147971)).(supplied by OMIM, Mar 2008).
Image Unavailable-103008-238

Human beta-CGRP

Catalog Number: (103008-238)
Supplier: Anaspec Inc
Description: This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10231-962

Anti-GCH1 Rabbit Polyclonal Antibody

Catalog Number: (10231-962)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Product Image-CA90003-672

BD BBL™ Diagnostic Reagent and Stain Droppers, BD Diagnostics

Catalog Number: (CA90003-672)
Supplier: BD
Description: Reagents are hermetically sealed in an ampule to protect from chemical instability

SDS Certificates


Image Unavailable-TCD0599-001G

3-(3,4-Dihydroxyphenyl)-DL-alanine ≥98.0% (by titrimetric analysis)

Catalog Number: (TCD0599-001G)
Supplier: TCI America
Description: CAS Number: 63-84-3
MDL Number: MFCD00063060
Molecular Formula: C9H11NO4
Molecular Weight: 197.19
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 272

SDS Certificates


Product Image-76734-860

Human FARSLB ELISA Kit

Catalog Number: (76734-860)
Supplier: ANTIBODIES.COM LLC
Description: Human FARSLB ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the in vitro quantitative determination of human FARSLB in serum, plasma, tissue homogenates, and other biological fluids.
Product Image-10087-946

Anti-GSTZ1 Rabbit Polyclonal Antibody

Catalog Number: (10087-946)
Supplier: Proteintech
Description: Glutathione transferase zeta 1(GSTZ1) catalyzes the biotransformation of a range of α-haloacids, including dichloroacetic acid (DCA), and the penultimate step in the tyrosine degradation pathway. GSTZ1 is preferentially expressed in hepatocytes and renal proximal tubule cells where phenylalanine and tyrosine are catabolized. This protein has 3 isoforms produced by alternative splicing.
Image Unavailable-103009-064

ClearPoint™ Human Beta-Amyloid (1-38), 13C-Phe & Ile

Catalog Number: (103009-064)
Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-38) with phenylalanine and isoleucine universally labeled with 13C. Ab is found in amyloid deposits of Alzheimer’s patients and is implicated in the pathogenesis of this disease.
Sequence: DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
Molecular Weight: 4161.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-10232-068

Anti-GCH1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10232-068)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Image Unavailable-10232-142

Anti-GCH1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10232-142)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Image Unavailable-10232-072

Anti-GCH1 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10232-072)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Image Unavailable-10232-070

Anti-GCH1 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10232-070)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Image Unavailable-10092-132

Anti-Pepsinogen I Rabbit Polyclonal Antibody

Catalog Number: (10092-132)
Supplier: Proteintech
Description: Pepsinogen I belongs to the peptidase A1 family. It shows particularly broad specificity and although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent. The gene endoces a 388 amino acid protein with a 15 amino acid signal peptide and 46 amino acid propeptide. This antibody can recognize PGA3(pepsinogen 3), PGA4(pepsinogen 4), PGA5(pepsinogen 5).
Image Unavailable-10232-140

Anti-GCH1 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10232-140)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Image Unavailable-10232-144

Anti-GCH1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10232-144)
Supplier: Bioss
Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
209 - 224 of 1,580
no targeter for Bottom