Print…

You Searched For: 2,7-Dibromo-9-phenylcarbazole


4,123  results were found

Refine Results Sort by
SearchResultCount:"4123"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-692

Human Gastrin Releasing Peptide

Supplier: Anaspec Inc
Description: Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Sequence: VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
MW: 2859.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-H-1308.0250BA

H-Gly-Asp-Gly-OH

Catalog Number: (H-1308.0250BA)
Supplier: Bachem Americas
Description: GDG.
Image Unavailable-G-1290.0005BA

H-Ala-Lys-OH · HCl, Bachem

Supplier: Bachem Americas
Description: [6366-77-4] (net)

Image Unavailable-G-4710.0250BA

Cyclo(-D-Ala-Val)

Supplier: Bachem Americas
Description: Also known as dioxopiperazines, piperazine-2,5-diones or DKPs. Diketopiperazines may occur as by-products during peptide synthesis or during the degradation of peptides. These cyclic dipeptides have been detected as taste-modulating compounds in food, they often show biological activity. DKPs are valuable chiral synthons, employed e.g. in Schöllkopf's versatile bislactim ether approach. They also have found use as catalysts for enantioselective synthesis, e.g. in the asymmetric Strecker reaction. See also the TRH metabolite cyclo(-His-Pro), G-1745, and cyclo(-Asp-Phe), G-1695, the major degradation product of aspartame.

Product Image-76444-882

HALO® C8, HPLC Columns, Advanced Materials Technology

Supplier: Advanced Materials Technology
Description: HALO® C8 columns made with innovative Fused-Core® particle technology for excellent reproducibility and column lifetimes provide fast, high-resolution separations. Available in three particle sizes and a wide range of column dimensions, HALO® 90 Å C8 columns are optimized for high performance in HPLC, UHPLC and LCMS small molecule applications.

Image Unavailable-103870-982

Human Recombinant IL-13 R alpha 2 (from HEK293 cells)

Catalog Number: (103870-982)
Supplier: ACROBIOSYSTEMS INC MS
Description: Human IL-13 R alpha 2 Protein, Fc Tag (MALS verified), ACROBiosystems
Product Image-77750-606

Human Recombinant EBI3 (from E. coli)

Supplier: VWR International
Description: Epstein-Barr virus induced gene-3 (EBI3) is a secreted glycoprotein belonging to the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). EBI3 expression is induced in B-lymphocytes in response to Epstein-Barr virus infection. EBI3 forms heterodimers with p28 to form interleukin 27 (IL-27), and with p35 to form interleukin 35 (IL-35). Both IL-27 and IL-35 have anti-inflammatory and regulatory activity.     

New Product

Image Unavailable-89299-524

Anti-NPPB Mouse Monoclonal Antibody [clone: B915M]

Catalog Number: (89299-524)
Supplier: Genetex
Description: Mouse Monoclonal antibody [B915M] to proBNP (N-term (a.a. 13-27))
Product Image-47749-472

Ashless Quantitative Paper, Grade 74, Ahlstrom

Catalog Number: (47749-472)
Supplier: Ahlstrom
Description: Ahlstrom Grade 74 is a medium flow rate ashless (Ash 0.007%) filter paper suitable for routine quantitative gravimetric techniques.
Product Image-47749-444

Ashless Quantitative Paper, Grade 54, Ahlstrom

Catalog Number: (47749-444)
Supplier: Ahlstrom
Description: Ahlstrom Grade 54 is a fast filtering ashless (Ash 0.007%) filter paper suitable for routine quantitative gravimetric techniques.
Product Image-93000-980

Miscellaneous Dissolution Accessories, Quality Lab Accessories

Catalog Number: (93000-980)
Supplier: QLA
Description: Everclear Water Bath Preservative is a crystalline formula offered in premeasured vials for use with dissolution water baths.Use with DEIONIZED water
Product Image-47749-626

Qualitative Filter Paper, Grade 237, Ahlstrom

Catalog Number: (47749-626)
Supplier: Ahlstrom
Description: Ahlstrom Grade 237 is a high absorbency grade that is twice as thick as Grade 642 with similar particle retention.
Image Unavailable-TCD4067-5G

2,5-Dibromohydroquinone ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 14753-51-6
MDL Number: MFCD00192664
Molecular Formula: C6H4Br2O2
Molecular Weight: 267.90
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 193

SDS Certificates

Product Image-47749-456

Hardened Ashless Quantitative Paper, Grade 55, Ahlstrom

Catalog Number: (47749-456)
Supplier: Ahlstrom
Description: Ahlstrom Grade 55 is a fast filtering hardened ashless (Ash 0.006%) filter paper suitable for quantitative gravimetric analysis of coarse particles and gelatinous precipitates in analytical techniques requiring increased wet strength and handling capacity.
Product Image-97063-658

VWR® Ultra Pure Grade Phosphate Buffered Saline

Supplier: VWR
Description: 1X Solution Composition:137 mM NaCl, 2.7 mM KCl, 9.5 mM Phosphate buffer

SDS Certificates

Product Image-KT850100-0027

KONTES® Solid Pennyhead [ST] Stoppers, Kimble Chase

Catalog Number: (KT850100-0027)
Supplier: DWK Life Sciences (KIMBLE)
Description: Glass stoppers for use with flasks, mixing cylinders, separatory funnels, and more

Certificates


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,121 - 1,136 of 4,123
no targeter for Bottom