Print…

You Searched For: 2,7-Dibromo-9,9-dihexylfluorene


11,191  results were found

Refine Results Sort by
SearchResultCount:"11191"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-77979-023

TRC 1-Bromo-2-octyne

Catalog Number: (77979-023)
Supplier: LGC Standards
Description: TRC 1-Bromo-2-octyne

New Product


Image Unavailable-102996-258

Human;Sheep;Rat PACAP (6-38), amide

Supplier: Anaspec Inc
Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-77553-798

Human Recombinant ABL1 (F317L, GST tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (F317L) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag.

New Product

Image Unavailable-77553-786

Human Recombinant ABL1 (Y253H, His tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (Y253H) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag.

New Product

Image Unavailable-77553-766

Human Recombinant ABL1 (T315I, GST tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (T315I) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag.

New Product

Image Unavailable-CAAAA12989-14

Oil red O

Supplier: Thermo Scientific Chemicals
Description: Suitable as a lipid and lipoprotein stain on cellulose acetate

Certificates

Image Unavailable-CAAAA16212-14

2',7'-Dichlorofluorescein

Supplier: Thermo Scientific Chemicals
Description: As a fluorescent indicator

Certificates

Product Image-10854-016

Headspace Crimp Vials, 20 mm, Restek

Supplier: Restek
Description: Headspace vials with different volumes and outside diameters are available in a variety of bottom shapes.

Image Unavailable-77980-922

TRC Cyromazine

Catalog Number: (77980-922)
Supplier: LGC Standards
Description: TRC Cyromazine

New Product


Image Unavailable-TCB5414-1G

tert-Butyl 4-Formylbenzoate ≥98.0% (by GC)

Catalog Number: (TCB5414-1G)
Supplier: TCI America
Description: Tert-Butyl 4-Formylbenzoate, Purity: >98.0%(GC), Cas no: 65874-27-3, Molecular formula : C12H14O3, Molecular weight : 206.24, Synonyms: 4-(tert-Butoxycarbonyl)benzaldehyde, 4-Formylbenzoic Acid tert-Butyl Ester, Size: 1G
Image Unavailable-RL009-001-B66

Human Recombinant IL-27B (from E. coli)

Catalog Number: (RL009-001-B66)
Supplier: Rockland Immunochemical
Description: Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209 amino acids with a molecular weight of 23.3 kDa.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-77980-750

TRC m-Cumenyl Phosphate

Supplier: LGC Standards
Description: TRC m-Cumenyl Phosphate

New Product

Image Unavailable-77988-163

TRC Loratadine-d4

Catalog Number: (77988-163)
Supplier: LGC Standards
Description: TRC Loratadine-d4

New Product


Image Unavailable-77979-720

TRC D-(+)-Cellopentaose

Catalog Number: (77979-720)
Supplier: LGC Standards
Description: TRC D-(+)-Cellopentaose

New Product


Image Unavailable-77993-316

TRC Solerole

Catalog Number: (77993-316)
Supplier: LGC Standards
Description: TRC Solerole

New Product


Image Unavailable-77553-772

Human Recombinant ABL1 (Y253F, GST tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (Y253F) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag.

New Product

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,073 - 1,088 of 11,191
no targeter for Bottom