Print…

You Searched For: 2,6-Difluoro-4-hydroxybenzoic+acid


73,447  results were found

Refine Results Sort by
SearchResultCount:"73447"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-76120-486

Anti-ANKRD26 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76120-486)
Supplier: Bioss
Description: Ankyrins are membrane adaptor molecules that play important roles in coupling integral membrane proteins to the spectrin-based cytoskeleton network. Mutations of ankyrin genes lead to severe genetic diseases such as fatal cardiac arrhythmias and hereditary spherocytosis. ANKRD26 (ankyrin repeat domain-containing protein 26) is a 1709 amino acid protein that contains five ANK repeats. Expressed at high level in many tissues, including brain, liver, kidney and heart, ANKRD26 may be phosphorylated upon DNA damage by Atm or ATR. ANKRD26 is also expressed in the arcuate and ventromedial nuclei within the hypothalamus and in the ependyma and the circumventricular organs that act as an interface between the peripheral circulation and the brain. It is suggested that alterations in the gene encoding ANKRD26 may lead to obesity. Three isoforms of ANKRD26 exists due to alternative splicing events.
Image Unavailable-CAAAAA16899-18

Bromophenol blue sodium salt

Supplier: Thermo Scientific Chemicals
Description: Tracking dye for alkaline and neutral buffer systems, for nucleic acid staining

Certificates

Image Unavailable-CA11027-328

Iron metal 100 Mesh, reduced

Catalog Number: (CA11027-328)
Supplier: Spectrum Chemicals
Description: Iron Metal, Reduced, 100 Mesh, Powder is a chemical element that has for a symbol Fe and the atomic number 26. Iron, in a powdered form is combined with and acidic solvent and used in the Bechamp reduction, to reduce nitrobenzene to aniline. It is also used in water purification and in the sewage treatment process, as a coloring agent in paint, an additive in animal feed as well as an etchant for copper

SDS


Image Unavailable-75791-996

Human Recombinant IFN alpha 2b (from E. coli)

Catalog Number: (75791-996)
Supplier: Prosci
Description: At least 23 different variants of IFN- alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- alpha subtypes differ in their sequences by only one or two positions. Naturally occurring variants also include proteins that are truncated by 10 amino acids at the carboxyl-terminal end.
Image Unavailable-CA1.01517.1000

Silver sulfate 10 g/L in sulphuric acid (d = 1.84 g/mL) for COD determination, Supelco®

Supplier: MilliporeSigma

SDS Certificates

Image Unavailable-CAAA11589-36

Zinc phosphate hydrate, tech.

Supplier: Thermo Scientific Chemicals
Description: Soluble in acetic acid, dilute mineral acids, ammonia. Insoluble in water

Certificates

Image Unavailable-CAAAAA17951-0J

2-Hydroxypropyl methacrylate (mixture of isomers) 98% stabilized

Supplier: Thermo Scientific Chemicals
Description: 2-Hydroxypropyl methacrylate (mixture of isomers) 98% stabilized

Certificates

Image Unavailable-10354-682

Anti-SIGLEC10 Rabbit Polyclonal Antibody (Alexa Fluor® 488)

Catalog Number: (10354-682)
Supplier: Bioss
Description: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC10 interacts with PTPN6/SHP-1 upon phosphorylation. The protein is expressed by peripheral blood leukocytes (eosinophils, monocytes and a natural killer cell subpopulation).
Product Image-10109-728

Anti-ST3 beta-galactoside alpha-2,3-sialyltransferase 4 Rabbit Polyclonal Antibody

Catalog Number: (10109-728)
Supplier: Prosci
Description: Synthesis of alpha-2,3-linked sialic acid to Gal (beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.
Image Unavailable-75791-604

Mouse Recombinant IL1RA (from E. coli)

Catalog Number: (75791-604)
Supplier: Prosci
Description: Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1 beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouse Il1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26% and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
Image Unavailable-10779-108

Human;Mouse;Rat Recombinant BMP-2 (from CHO cells)

Supplier: Peprotech
Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with an osteoconductive carrier such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 appears to play an important role in cardiac morphogenesis, and is expressed in a variety of other tissues, including lung, liver, spleen, prostate, ovary, and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains (monomers) linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human/Murine/Rat BMP-2 derived from

Product Image-CAJT1266-5

Calcium acetate monohydrate 99.0-101.0%, powder, BAKER ANALYZED® ACS, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Powder. Lot analysis on label.

Certificates

Image Unavailable-102996-422

Human Brain Natriuretic Peptide 32

Supplier: Anaspec Inc
Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-10072-844

Human Recombinant IL19 (from E. coli)

Catalog Number: (10072-844)
Supplier: Prosci
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.
Image Unavailable-CA1.01574.1000

Silver sulfate 80 g/L in sulphuric acid (d = 1.84 g/mL) DIN 38409-H43-1 for COD determination according to DIN 38409-41, volumetric solution, Supelco®

Catalog Number: (CA1.01574.1000)
Supplier: MilliporeSigma

SDS


Product Image-10096-776

Anti-UMP/CMP kinase Rabbit Polyclonal Antibody

Catalog Number: (10096-776)
Supplier: Proteintech
Description: Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. It plays a crucial role in the formation of UDP, CDP, and dCDP, which are required for cellular nucleic acid synthesis. CMPK1 can use a broad spectrum of phosphate donors but the best phosphate donors are ATP and dATP. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD. However, translation likely begins at the second initiation methionine, resulting in a protein of 196 amino acids. The shorter form is the endogenously translated protein.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
561 - 576 of 73,447
no targeter for Bottom