Print…

You Searched For: 2,3-Dimethylphenylboronic+acid


70,142  results were found

Refine Results Sort by
SearchResultCount:"70142"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10771-016

Rat Recombinant FGF-basic (from E. coli)

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Rat FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

Image Unavailable-103006-912

Histone H3 (1-21), Biotin

Catalog Number: (103006-912)
Supplier: Anaspec Inc
Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a biotinylated lysine. This peptide was used to investigate the characteristics and mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes. Immunocytochemical and immunoblot analyses revealed that ethanol treatment significantly increased H3 acetylation at Lys9 with negligible effects at Lys14, 18, and 23.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2723.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10483-438

Anti-DCAF11 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10483-438)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-76108-702

Anti-WDR23 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76108-702)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-102996-080

Rat Atrial Natriuretic Peptide (1-28)

Supplier: Anaspec Inc
Description: Rat ANP differs from the human hormone by only one residue at position 12. ANP (1-28) peptide hormone constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3062.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-103007-210

Human [Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-210)
Supplier: Anaspec Inc
Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-75811-390

Hydrochloric acid 37% FCC

Supplier: Spectrum Chemical Mfg. Corp.
Description: Hydrochloric Acid, 37 Percent, FCC is used in food processing, or as a food additive to adjust the pH. The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.

Certificates

Product Image-10088-762

Anti-IL12RB1 Rabbit Polyclonal Antibody

Catalog Number: (10088-762)
Supplier: Proteintech
Description: IL12RB1, also named as Interleukin-12 receptor subunit beta-1 or CD212, is a 662 amino acid protein, which contains 5 fibronectin type-III domains and belongs to the type I cytokine receptor family. Type 2 subfamily. IL12RB1 localizes in the membrane and functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.
Image Unavailable-10669-740

Anti-RNF23 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10669-740)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Image Unavailable-10669-742

Anti-RNF23 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10669-742)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Product Image-10082-282

Anti-AARS2 Rabbit Polyclonal Antibody

Catalog Number: (10082-282)
Supplier: Proteintech
Description: AARS2(Alanine--tRNA ligase, mitochondrial) is also named as KIAA1270, AARSL, bA444E17.1, AlaRS, AARSL, COXPD8, MTALARS, MT-ALARS and belongs to the class-II aminoacyl-tRNA synthetase family. It catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). It also edits incorrectly charged tRNA(Ala) via its editing domain. The full length 107 kDa protein has a transit peptide with 23 amino acids.
Image Unavailable-H-3046.0500BA

Bovine;Human;Pig Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) Trifluoroacetate

Supplier: Bachem Americas
Description: Urodilatin, a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation. The use of H-3046 is protected by patents. It is sold by Bachem for research purposes only, by expressed permission of Pharis Biotec GmbH, Hannover, Germany (www.pharis-biotec.com).

Image Unavailable-10669-724

Anti-RNF23 Rabbit Polyclonal Antibody

Catalog Number: (10669-724)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Image Unavailable-10669-738

Anti-RNF23 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10669-738)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Image Unavailable-89519-776

Anti-ASIC4 Rabbit Polyclonal Antibody

Catalog Number: (89519-776)
Supplier: Abgent
Description: Western Blot: 1:1000
Image Unavailable-89515-558

Anti-PAIP1 Rabbit Polyclonal Antibody

Catalog Number: (89515-558)
Supplier: Abgent
Description: Western Blot: 1:1000
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 70,142
no targeter for Bottom