You Searched For: 2,3-Dimethylphenylboronic+acid


70,142  results were found

SearchResultCount:"70142"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76085-302)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Catalog Number: (76085-300)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Supplier: Peprotech
Description: SCF is a hematopoietic growth factor that exerts its activity by signaling through the c-Kit receptor. SCF and c-Kit are essential for the survival, proliferation and differentiation of hematopoietic cells committed to the melanocyte and germ cell lineages. Human SCF manifests low activity on murine cells, while murine and rat SCF are fully active on human cells. The human SCF gene encodes for a 273 amino acid transmembrane protein, which contains a 25 amino acid N-terminal signal sequence, a 189 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 36 amino acid cytoplasmic domain. The secreted soluble form of SCF is generated by proteolytic processing of the membrane anchored precursor. Recombinant Murine SCF is an 18.3 kDa polypeptide containing 165 amino acid residues, which corresponds to the sequence of the secreted soluble form of SCF.
Supplier: Peprotech
Description: SCF is a hematopoietic growth factor that exerts its activity by signaling through the c-Kit receptor. SCF and c-Kit are essential for the survival, proliferation and differentiation of hematopoietic cells committed to the melanocyte and germ cell lineages. Human SCF manifests low activity on murine cells, while murine and rat SCF are fully active on human cells. The human SCF gene encodes for a 273 amino acid transmembrane protein, which contains a 25 amino acid N-terminal signal sequence, a 189 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 36 amino acid cytoplasmic domain. The secreted soluble form of SCF is generated by proteolytic processing of the membrane anchored precursor. Recombinant Rat SCF is an 18.4 kDa polypeptide containing 165 amino acid residues, which corresponds to the sequence of the secreted soluble form of SCF.

Catalog Number: (103006-666)
Supplier: Anaspec Inc
Description: This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (75835-376)
Supplier: Restek
Description: Contains: n-decane, C10, 280 µg/ml, methyl decanoate, C10:0, 420 µg/ml, n-undecane, C11, 280 µg/ml, methyl undecanoate, C11:0, 420 µg/ml, methyl dodecanoate, C12:0, 420 µg/ml, L(+)-2,3-butanediol, 530 µg/ml, 2,6-dimethylaniline, 320 µg/ml, 2,6-dimethylphenol, 320 µg/ml, 2-ethylhexanoic acid, 380 µg/ml, nonanal, 400 µg/ml, 1-octanol, 360 µg/ml.


Supplier: Peprotech
Description: ICAMs are members of the Ig superfamily of calcium-independent transmembrane glycoproteins. ICAM-1 is a ligand for the lymphocyte function-associated antigen (LFA) and Mac-1 integrins, as well as the major human rhinovirus receptor. The primary function of ICAM-1 is to provide adhesion between endothelial cells and leukocytes after stress or injury. The human ICAM-1 gene codes for a 505 amino acid transmembrane glycoprotein containing a 29 amino acid cytoplasmic domain, a 23 amino acid transmembrane domain, and a 453 amino acid extracellular domain. Recombinant Human ICAM-1 is a 49.5 kDa glycoprotein comprising the extracellular domain (453 amino acid residues) of ICAM-1. Monomeric glycosylated ICAM-1 migrates at an apparent molecular weight of approximately 72.0-80.0 kDa by SDS-PAGE analysis under reducing conditions.

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10082-820)
Supplier: Proteintech
Description: GFER(FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria.The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus.


Supplier: Thermo Scientific Chemicals
Description: Waterproofing and release agent, stabilizer for PVC, lubricant, conditioning agent
Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF/FGF-7 signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF (FGF-7) signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Murine FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

Supplier: Prosci
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant human FGF-basic is a 17.2 kDa protein consisting of 154 amino acid residues. Recombinant murine FGF-basic is a 16.2 kDa protein consisting of 145 amino acid residues.

Catalog Number: (TCC2899-200MG)
Supplier: TCI America
Description: CAS Number: 55804-65-4
MDL Number: MFCD00051335
Molecular Formula: C16H15NO4
Molecular Weight: 285.30
Form: Crystal
Color: Yellow
Melting point (°C): 235
Lambda max.: 446 nm (EtOH)

SDS


Supplier: Peprotech
Description: Human soluble DLL-1 comprises the extracellular signaling domain of DLL-1, a member of the Delta/Serrate/Lag-2 (DSL) family of single-pass type I trans-membrane proteins that serve as ligands for Notch receptors. It is expressed primarily in the heart, pancreas and epidermis. DLL-1 functions to specifically activate the Notch-1 and Notch-2 receptors. Proteolytic cleavage of DLL-1 produces a secreted extracellular domain, sDLL-1, that interacts with Notch receptors expressed on adjacent cells. Notch signaling plays an essential role in controlling cell fate decisions during prenatal development and postnatal stem cell renewal, and differentiation in many tissues. Human sDLL-1 blocks monocyte differentiation into macrophages, but permits differentiation into dendritic cells. In hematopoietic progenitor cells, hsDLL-1, suppresses differentiation into B-cells, while promoting differentiation into T-cells and NK cell precursors. In cell culture, human sDLL-1 has been shown to promote expansion of hematopoietic progenitor cells and suppress apoptosis by inhibiting differentiation. Overexpression of Notch receptors appears to inhibit differentiation in several mammalian cell lines, and increasing evidence suggests that Notch signaling is frequently downregulated in human malignancies. The human DLL-1 gene consists of a 528 amino acid extracellular domain with one DSL domain, eight EGF-like repeats, a 23 amino acid transmembrane domain, and a 155 amino acid cytoplasmic domain. The calculated molecular weight of Recombinant Human sDLL-1 is 56.3 kDa.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
657 - 672 of 70,142
no targeter for Bottom