You Searched For: (3-Fluorophenyl)acetic+acid


66,780  results were found

SearchResultCount:"66780"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA009-001-103)
Supplier: Rockland Immunochemical
Description: 0.5mg. Protein Concentration: 1 mg/mL. Buffer: 0.5M acetic acid, pH 4.5. Stabilizer: None. Preservative: None. For research. Sterile filtered liquid.

SDS


Catalog Number: (RC1120-16)
Supplier: Ricca Chemical
Description: Picric acid-formalin-acetic acid mixture.

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00042553 Practically insoluble in water, acetone, and glacial acetic acid
Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned ZraI gene from Zoogloea ramigera 11, (S.K. Degtyarev).

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: New England Biolabs (NEB)
Description: MluI-HF is produced in E. coli from a strain that carries the cloned and modified MluI gene from Micrococcus luteus (IFO 12992)

Catalog Number: (CA8.03235.9026)
Supplier: MilliporeSigma

Supplier: New England Biolabs (NEB)
Description: NruI-HF is produced in E. coli from a strain that carries the cloned and modified NruI gene from Nocardia rubra (ATCC 15906).

Supplier: MilliporeSigma
Description: N,N-Dimethylacetamide ≥98% (by GC), Supelco®
Supplier: TCI America
Description: CAS Number: 878-00-2
MDL Number: MFCD00003384
Molecular Formula: C9H8O3
Molecular Weight: 164.16
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 265
Flash Point (°C): 110
Specific Gravity (20/20): 1.18

SDS

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00009203 Beilstein Registry No.: 1744677
Supplier: TCI America
Description: CAS Number: 137076-54-1
MDL Number: MFCD02259697
Molecular Formula: C28H52N4O8
Molecular Weight: 572.74
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Color: White
Storage Temperature: 0-10°C

SDS

Supplier: TCI America
Description: CAS Number: 125572-95-4
MDL Number: MFCD00149243
Molecular Formula: C14H22N2O8
Molecular Weight: 346.34
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 216
Supplier: Thermo Scientific Chemicals
Description: Creatine (N-amidinosarcosine), anhydrous 98%
Catalog Number: (E-2920.0005BA)
Supplier: Bachem Americas
Description: Sequence: Abz-Gly-OH · HCl


Catalog Number: (CA8.00077.0250)
Supplier: MilliporeSigma
Description: 4'-Methylacetanilide, CAS number:103-89-9, Synonyms:N-p-Tolylacetamide, Acetic acid p-toluidide, 4-Acetamidotoluene, Application:for synthesis

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,041 - 1,056 of 66,780
no targeter for Bottom