Print…

You Searched For: \u03B1-Bromo-4-nitrotoluene


0  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"0"

Rate These Search Results

Image Unavailable-10325-164

Anti-ADAR Rabbit Polyclonal Antibody (Cy5.5®)

Description: ADAR1 converts adenosine to inosine in dsRNA, which destabilizes the dsRNA helix. This activity is important for various functions like site-specific RNA editing of transcripts of the glutamate receptors and modifying viral RNA genomes (which may be responsible for hypermutation of certain negative-stranded viruses, e.g., measles virus). ADAR1 also binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. This protein is ubiquitously expressed, with the highest levels being found in brain and lung.
Catalog Number: 10325-164
Supplier: Bioss
Image Unavailable-10325-162

Anti-ADAR Rabbit Polyclonal Antibody (Cy5®)

Description: ADAR1 converts adenosine to inosine in dsRNA, which destabilizes the dsRNA helix. This activity is important for various functions like site-specific RNA editing of transcripts of the glutamate receptors and modifying viral RNA genomes (which may be responsible for hypermutation of certain negative-stranded viruses, e.g., measles virus). ADAR1 also binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. This protein is ubiquitously expressed, with the highest levels being found in brain and lung.
Catalog Number: 10325-162
Supplier: Bioss
Product Image-10751-600

Anti-VKORC1 Rabbit Polyclonal Antibody

Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.
Catalog Number: 10751-600
Supplier: Prosci
Product Image-10075-468

Anti-DLG4 Rabbit Polyclonal Antibody

Description: PSD-95 is a very prominent component of the postsynaptic densities of synapses. It contains three PDZ domains which play key roles in its interactions with other proteins in the synapse. It has been proposed that these PDZ domains organize glutamate receptors and their associated signaling proteins and determine the size and strength of synapses (Kim and Sheng, 2004). Recent work suggests that interaction of the NMDAR with PSD-95 via these PDZ domains can be regulated by phosphorylation (Chung et al., 2004).
Catalog Number: 10075-468
Supplier: Prosci
Image Unavailable-89267-206

Anti-GLUD2 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to GLUD2 (N-terminal)
Catalog Number: 89267-206
Supplier: Genetex
Product Image-77049-472

Anti-Glutamate Receptor 1 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77049-472
Supplier: ANTIBODIES.COM LLC
Product Image-77049-476

Anti-Glutamate Receptor 1 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77049-476
Supplier: ANTIBODIES.COM LLC
Image Unavailable-89366-258

Anti-GRIA2 Rabbit Polyclonal Antibody

Description: Rabbit Polyclonal Antibody to GRIA2
Catalog Number: 89366-258
Supplier: Genetex
Image Unavailable-89265-980

Anti-NR2B Mouse Monoclonal Antibody [clone: S59-36]

Description: Mouse Monoclonal antibody [S59-36] to NR2B
Catalog Number: 89265-980
Supplier: Genetex
Product Image-77060-996

Anti-Metabotropic Glutamate Receptor 7 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to GRM7 for WB and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77060-996
Supplier: ANTIBODIES.COM LLC
Image Unavailable-89294-810

Anti-GRM1 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to GRM1
Catalog Number: 89294-810
Supplier: Genetex
Image Unavailable-89294-696

Anti-GRM7 Goat Polyclonal Antibody

Description: Goat polyclonal antibody to GRM7
Catalog Number: 89294-696
Supplier: Genetex
Image Unavailable-10795-304

Anti-GRM3 Rabbit Polyclonal Antibody

Description: Rabbit Polyclonal antibody to mGluR3
Catalog Number: 10795-304
Supplier: Genetex
Image Unavailable-89302-970

Anti-GOT1 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal to GOT1 (N-term)
Catalog Number: 89302-970
Supplier: Genetex
Image Unavailable-89306-706

Anti-GAD2 Rabbit Polyclonal Antibody

Description: Rabbit Polyclonal antibody to GAD65
Catalog Number: 89306-706
Supplier: Genetex
Image Unavailable-103007-114

Human [Gly22]-beta-Amyloid (1-42)

Description: This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-114
Supplier: Anaspec Inc
241 - 0 of 0