You Searched For: BIO PLAS INC.


0  results were found

SearchResultCount:"0"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Cytiva
Description: Mono-functional maleimides are particularly suitable for the selective labelling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides.
Supplier: Enzo Life Sciences
Description: PKC inhibitor

Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-442)
Supplier: Anaspec Inc
Description: R-Phycoerythrin (R-PE), a fluorescent protein from phycobiliprotein family, is isolated from red algae. SMCC Activated R-PE is chemically modified with SMCC. SMCC reacts with the primary amine on R-PE and introduces maleimide groups to R-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of R-PE with proteins. R-PE’s primary absorption peak is at 565 nm with secondary peaks at 496 and 545 nm. The broad excitation spectrum provides the advantage for multi-color immunofluorescent staining or cell sorting. R-PE and the closely related BPE are the most intensely fluorescent phycobiliproteins with orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. R-PE conjugates are widely used in applications such as flow cytometry, live cell staining, and immunofluorescent staining.


Supplier: Bachem Americas
Description: Sequence: 5(6)-Carboxy-tetramethylrhodamine
Synonym(s): 5(6)-TAMRA

Catalog Number: (RL200-342-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.


Catalog Number: (RL200-343-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.


Catalog Number: (RL200-344-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was prepared by repeated immunizations of mice with a synthetic peptide corresponding to the 6X HIS epitope tag (H-H-H-H-H-H) conjugated to KLH using maleimide.


Supplier: Thermo Scientific Chemicals
Supplier: Biotium
Description: Biotium offers a number of reactive dye formats for labelling proteins, nucleic acids, and other biomolecules with fluorescent dyes. CF® dyes offer advantages in brightness and photostability compared other similar commercial dyes. CF® dyes are available in a number of reactive dye formats for CF® dye colours span the visible and near-infrared spectra.

Supplier: Cytiva
Description: CyDye™ Mono-Reactive Maleimide Fluorescent Dyes are intensely fluorescent and highly water soluble, providing significant advantages over other existing fluorophores.

Catalog Number: (RL200-341-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.


Catalog Number: (10077-084)
Supplier: Prosci
Description: Monoclonal, Host: Mouse, Clone: TU-20, Immunogen: Peptide (C) 441-448 coupled to maleimide-activated keyhole limpet hemocyanin N-Terminus of the neuron-specific peptide, Isotype: IgG1, Tested Application: western blot, Immunohistochemistry, .


Catalog Number: (10080-568)
Supplier: Prosci
Description: Polyclonal, Host: Rabbit, Species reacivity: human, Immunogen: Synthetic peptide corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide, Tested application: ELISA, IF, IHC, IP, WB


Supplier: Thermo Scientific Chemicals
Description: 3-Maleimidopropionic acid, 95%
Catalog Number: (CAPI22360)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce SMCC is a hetero-bifunctional crosslinker that contain N-hydroxysuccinimide (NHS) ester and maleimide groups that allow covalent conjugation of amine- and sulfhydryl-containing molecules. NHS esters react with primary amines at pH 7–9 to form amide bonds, while maleimides react with sulfhydryl groups at pH 6.5–7.5 to form stable thioether bonds. In aqueous solutions, NHS ester hydrolytic degradation is a competing reaction whose rate increases with pH. The maleimide group is more stable than the NHS-ester group, but will slowly hydrolyze and lose its reaction specificity for sulfhydryls at pH values > 7.5. For these reasons, conjugations with these crosslinkers are usually performed at pH 7.2–7.5, with the NHS ester (amine-targeted) reacted before or simultaneous with the maleimide (sulfhydryl-targeted) reaction.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,105 - 0 of 0
no targeter for Bottom