You Searched For: Gadolinium+trichloride

Catalog Number: (75788-866)

Supplier: Prosci

Description: Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways.

Catalog Number: (103008-238)

Supplier: Anaspec Inc

Description: This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Diagnostic Biosystems

Description: This antibody recognizes the CD8. The CD8 molecule consists of two chains, α and β, which are expressed as a disulphide-linked α/β heterodimer or as an α/α homodimer on T cell subset, thymocytes and NK cells. The majority of CD8+ T cells express CD8 as α/β heterodimer. CD8 functions as a coreceptor in concert with TCR for binding the MHC class I/peptide complex. The HIV-2 envelope glycoprotein binds CD8 α chain (but not β chain).

Catalog Number: (89324-218)

Supplier: Genetex

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: IHC-P, WB Pkg Size: 100 ul

Supplier: Thermo Scientific Chemicals

Description: Iron sulfide ≥99.9% (metals basis)

Certificates

Catalog Number: (75908-886)

Supplier: Biotium

Description: CD98 exits as a heterodimer containing a disulphide-linked glycosylated heavy chain and a non-glycosylated light chain. It is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through disulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Catalog Number: (10465-124)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.

Catalog Number: (10465-120)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.

Catalog Number: (10404-250)

Supplier: Bioss

Description: Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

Catalog Number: (CAPIPA526938)

Supplier: Thermo Scientific

Description: Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

Supplier: Biotium

Description: CD98 exits as a heterodimer containing a disulphide-linked glycosylated heavy chain and a non-glycosylated light chain. It is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through disulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Supplier: Biotium

Description: CD98 exits as a heterodimer containing a disulphide-linked glycosylated heavy chain and a non-glycosylated light chain. It is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through disulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Catalog Number: (76119-454)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.

Catalog Number: (10465-116)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.

Catalog Number: (10465-102)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.

Catalog Number: (10465-114)

Supplier: Bioss

Description: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. ERp19 and ERp46 are two newly discovered ER luminal proteins, related to protein disulphide isomerase. Western and Northern blot analyses have revealed that both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues. Both proteins are enriched in purified liver ER vesicles and were localized specifically to the ER in McA-RH7777 hepatocytes. See Knoblach et al. for details.