You Searched For: 3,6-Dihydroxybenzonorbornane


65,273  results were found

Sort Results

List View Easy View
SearchResultCount:"65273"
Description: , 850583-75-4, C14H8N2O2S2, 300.35
Catalog Number: TCD3969-5G
Supplier: TCI America

Description: , 7153-21-1, C10H8O8S2, 364.25
Catalog Number: TCD0595-500G
Supplier: TCI America

SDS


Description: , 7153-21-1, C10H8O8S2, 364.25
Catalog Number: TCD0595-025G
Supplier: TCI America

SDS


Description: N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane, Purity: >90.0%(HPLC), Cas number: 1263166-93-3, Molecular Formula: C17H28N2O4, Molecular Weight: 324.42, Size: 100MG, 1263166-93-3, C17H28N2O4, 324.42
Catalog Number: TCB4062-100MG
Supplier: TCI America

SDS


Description: N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane, Purity: >90.0%(HPLC), Cas number: 1263166-93-3, Molecular Formula: C17H28N2O4, Molecular Weight: 324.42, Size: 25MG, 1263166-93-3, C17H28N2O4, 324.42
Catalog Number: TCB4062-25MG
Supplier: TCI America

Description: , 4511-42-6, C6H8O4, 144.13
Catalog Number: TCL0115-250G
Supplier: TCI America

Description: , 4511-42-6, C6H8O4, 144.13
Catalog Number: TCL0115-025G
Supplier: TCI America

Description: GLP-1(9-36), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3089.5, Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, Appearance: Powder, rapid degradation of GLP-1 (7-36)amide, by enzyme dipeptidyl peptidase IV (DPP-4), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-696
Supplier: Anaspec Inc


Description: 1mg PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which sug gests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drug s for the treatment of obesity. CAS: 123583-37-9 C180H279N53O54 FW: 4049.52 . Synonym: PYY (3-36) (human)
Catalog Number: H-8585.1000BA
Supplier: Bachem Americas


Description: 0.5mg PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which sug gests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drug s for the treatment of obesity. CAS: 123583-37-9 C180H279N53O54 FW: 4049.52 . Synonym: PYY (3-36) (human)
Catalog Number: H-8585.0500BA
Supplier: Bachem Americas


Description: 1-tert-Butoxycarbonyl-1,2,3,6-tetrahydropyridine, Purity: >97.0%(GC), Cas: 85838-94-4, Molecular Formula: C10H17NO2, MW: 183.25, Synonyms: 1-Boc-1,2,3,6-tetrahydropyridine, tert-Butyl 1,2,3,6-Tetrahydropyridine-1-carboxylate, Size: 1G
Catalog Number: TCB4357-1G
Supplier: TCI America

SDS


Catalog Number: 76576-438
Supplier: AFG Bioscience


Description: Human Peptide YY (3-36)
Catalog Number: 102996-564
Supplier: Anaspec Inc


Description: 1mg (Tyr³6)-pTHrP (1-36) has been used for radioiodination. CAS: 213779-11-4 C194H303N59O53 FW: 4309.91 . Synonym: (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Catalog Number: H-3208.1000BA
Supplier: Bachem Americas


Description: 0.5mg (Tyr³6)-pTHrP (1-36) has been used for radioiodination. CAS: 213779-11-4 C194H303N59O53 FW: 4309.91 . Synonym: (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Catalog Number: H-3208.0500BA
Supplier: Bachem Americas


Description: Apelin - 36, human, peptide, inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses, Purity: HPLC >/= 95%, Sequence (One-Letter Code): LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF, MW: 4195.9, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-340
Supplier: Anaspec Inc


177 - 192 of 65,273