Print…

You Searched For: 1,4-Cyclohexadiene


19,077  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"19077"

Rate These Search Results

Image Unavailable-H-6885.0025BA

OXYTOCIN (FREE ACID)

Description: 25mg (Disulfide bond) CAS: 4248-64-0 C43H65N11O13S2 FW: 1008.19 . oxytocin
Catalog Number: H-6885.0025BA
Supplier: Bachem Americas
Image Unavailable-10770-582

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 2UG
Catalog Number: 10770-582
Supplier: Peprotech
Image Unavailable-10770-586

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 100UG
Catalog Number: 10770-586
Supplier: Peprotech
Image Unavailable-10770-600

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 250UG
Catalog Number: 10770-600
Supplier: Peprotech
Image Unavailable-10770-602

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 500UG
Catalog Number: 10770-602
Supplier: Peprotech
Image Unavailable-10770-584

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 10UG
Catalog Number: 10770-584
Supplier: Peprotech
Image Unavailable-10770-604

Recombinant Human PDGF-AB

Description: Recombinant Human PDGF-AB, 26.4 kDa disulfide-linked dimer, consisting of one Alpha chain and one Beta chain, Source: E.coli, Cross Reactivity: Monkey, Mouse, Human, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses. Synonym: PCGF, Pack Size: 1MG
Catalog Number: 10770-604
Supplier: Peprotech
Image Unavailable-H-4448.1000BA

CART (61-102) (HUMAN, RAT), 1mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART

Description: CART (61-102) (HUMAN, RAT), 1mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART
Catalog Number: H-4448.1000BA
Supplier: Bachem Americas
Image Unavailable-H-4448.0500BA

CART (61-102) (HUMAN, RAT), 0.5mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART

Description: CART (61-102) (HUMAN, RAT), 0.5mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART
Catalog Number: H-4448.0500BA
Supplier: Bachem Americas
Product Image-89142-056

ERP57, PAB 200 ug

Catalog Number: 89142-056
Supplier: Enzo Life Sciences
Product Image-89142-054

ERP57, PAB 50 ug

Catalog Number: 89142-054
Supplier: Enzo Life Sciences
Image Unavailable-103003-052

Amylin (1 - 37) 1 mg

Description: Amylin (1 - 37), human, amide, Purity: HPLC >/- 95%, Molecular Weight: 3903.3, Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-052
Supplier: Anaspec Inc
Image Unavailable-77436-708

ANTIBODY TXNDC4 POLYCLONAL 100UL

Catalog Number: 77436-708
Supplier: Bioss
Image Unavailable-76303-584

Recom >/= 98% E.coli Human PDGF-BB 50UG

Description: Animal-Free Human PDGF-BB, Recombinat, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses, Host: E.coli, Synonyms: Platelet-Derived Growth Factor-BB, Glioma-derived growth factor (GDGF), Osteosarcoma-derived Growth Factor (ODGF), Size: 50UG
Catalog Number: 76303-584
Supplier: Peprotech
Product Image-RK30007

CLP-Volatiles Organics Standards, VOA Calibration Mixture 2

Description: Packaged in purge and trap grade methanol at 2500ug/mL in a 1mL ampule. Each includes an ampule breaker, deactivated amber screw-top vial, extra product label, Certificate of Analysis and Material Safety Data Sheet. Contains 7 compounds.
Catalog Number: RK30007
Supplier: Restek

SDS


Image Unavailable-10778-838

Recombinant Murine EGF

Description: Recombinant Murine EGF, 6.0 kDa globular protein contain 53 AA residues, including 3 intramolecular disulfide bonds, potent growth factor, Animal-Free Cytokines, Source: E.coli, Cross Reactivity: Human, Mouse, >98%, Synonyms: Epidermal Growth Factor, Urogastrone, URG, 500UG
Catalog Number: 10778-838
Supplier: Peprotech
17 - 32 of 19,077