Print…

You Searched For: Hexafluoroglutaric+acid


25,884  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"25884"

Rate These Search Results

Product Image-10206-222

Anti-Integrin Beta 4 Polyclonal Antibody

Description: Polyclonal antibody for CD104/ITGB4 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. CD104/ITGB4 information: Molecular Weight: 202167 MW; Subcellular Localization: Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor. Cell junction, hemidesmosome. Colocalizes with DST at the leading edge of migrating keratinocytes; Tissue Specificity: Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoform beta-4D is also expressed in colon and placenta. Isoform beta-4E is also expressed in epidermis, lung, duodenum, heart, spleen and stomach.
Catalog Number: 10206-222
Supplier: Boster Biological Technology
Image Unavailable-10414-958

Anti-IKK beta Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number: 10414-958
Supplier: Bioss
Product Image-89419-186

Human beta-Actin Peptide (16 aa near N-terminus)

Description: Beta-actin peptide is used for blocking the activity of beta-actin antibody.
Catalog Number: 89419-186
Supplier: Prosci
Product Image-10209-944

Anti-IKK beta Rabbit Polyclonal Antibody

Description: Rabbit IgG polyclonal antibody for Inhibitor of nuclear factor kappa-B kinase subunit beta(IKBKB) detection. Tested with WB in Human;Mouse;Rat.
Catalog Number: 10209-944
Supplier: Boster Biological Technology
Image Unavailable-75788-818

Human Recombinant NGF beta (from E. coli)

Description: Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Catalog Number: 75788-818
Supplier: Prosci
Product Image-CA11012-722

Whatman™ Mixed Cellulose Ester Membranes, Non-Sterile, 1.2 µm

Description: Mixed cellulose ester, WME range, circles, gridded. Whatman mixed cellulose ester membranes are composed of cellulose acetate and cellulose nitrate. These membranes are characterized by a smoother and more uniform surface than pure nitrocellulose filters.
Catalog Number: CA11012-722
Supplier: Cytiva

SDS Certificates


Product Image-89419-184

Human beta-Actin Peptide (16 aa near C-terminus)

Description: Beta-actin peptide is used for blocking the activity of beta-actin antibody.
Catalog Number: 89419-184
Supplier: Prosci
Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-214
Supplier: Anaspec Inc
Product Image-10206-036

Anti-beta-HCG Mouse Monoclonal Antibody [clone: HCG-8]

Description: Mouse IgG monoclonal antibody for beta-HCG, chorionic gonadotropin, beta polypeptide (CGB) detection. Tested with IHC-P in Human. No cross reactivity with other proteins.
Catalog Number: 10206-036
Supplier: Boster Biological Technology
Image Unavailable-Q-2115.0025BA

Antazoline·0.5 H₂SO₄

Description: Sequence: 2-(N-Phenyl-N-benzyl-aminomethyl)-imidazoline · 0.5 H₂SO₄
Catalog Number: Q-2115.0025BA
Supplier: Bachem Americas
Image Unavailable-10414-982

Anti-IKK beta Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number: 10414-982
Supplier: Bioss
Image Unavailable-103007-598

Human Beta-Amyloid (11-42)

Description: This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-598
Supplier: Anaspec Inc
Product Image-10209-454

Anti-IL-1 beta Polyclonal Antibody

Description: Polyclonal antibody for IL 1 BETA/IL1B detection. Host: Rabbit.Size: 100μg/vial. Tested applications: ELISA. Reactive species: Rat. IL 1 BETA/IL1B information: Molecular Weight: 30644 MW; Subcellular Localization: Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
Catalog Number: 10209-454
Supplier: Boster Biological Technology
Image Unavailable-102943-716

Recombinant Beta-glucuronidase

Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Catalog Number: 102943-716
Supplier: Bon Opus Biosciences
Image Unavailable-10415-808

Anti-IKK beta Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number: 10415-808
Supplier: Bioss
Image Unavailable-H-2236.1000BA

Glutathione-monoisopropyl ester (reduced)

Description: Please see also 5-(Pentafluorobenzoylamino)fluorescein (M-2375), a sensitive fluorogenic substrate for the determination of glutathione S-transferase (GST) activity and glutathione (GSH) concentration, and the carba-analog of GSH, ophthalmic acid, H-3145.
Catalog Number: H-2236.1000BA
Supplier: Bachem Americas
1,345 - 1,360 of 25,884