Print…

You Searched For: beta-Alanine+benzyl+ester+p-toluenesulfonate


25,884  results were found

Refine Results Sort by
SearchResultCount:"25884"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-75789-604

Human Recombinant beta-1,4-Galactosyltransferase 4 (from Cells)

Catalog Number: (75789-604)
Supplier: Prosci
Description: beta -1,4-galactosyltransferase 4 (B4GALT4) is a single-pass type II membrane protein that belongs to the Glycosyltransferase 7 family
Product Image-76577-872

Mouse Beta-Endorphin (Beta-EP) ELISA Kit, AFG Bioscience

Catalog Number: (76577-872)
Supplier: AFG Bioscience
Description: Mouse Beta-Endorphin (Beta-EP) ELISA Kit, AFG Bioscience
Image Unavailable-103000-892

Human Beta-Amyloid (4-42)

Catalog Number: (103000-892)
Supplier: Anaspec Inc
Description: Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-89289-492

Anti-CD97 beta Rabbit Polyclonal Antibody

Catalog Number: (89289-492)
Supplier: Genetex
Description: Rabbit polyclonal antibody to CD97 beta (cleaved Ser531)
Product Image-89355-448

Anti-CAMKK beta Rabbit Polyclonal Antibody

Catalog Number: (89355-448)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to CaMKK beta (calcium/calmodulin-dependent protein kinase kinase 2, beta)
Image Unavailable-76080-394

Anti-IKK beta Ser740 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76080-394)
Supplier: Bioss
Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Image Unavailable-103359-172

Anti-beta Tubulin Rabbit Polyclonal Antibody

Catalog Number: (103359-172)
Supplier: Novus Biologicals
Description: The beta Tubulin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, bovine, canine, chicken, feline, monkey, primate, xenopus. The beta Tubulin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Image Unavailable-76236-756

Human NGF - NGF beta ELISA Kit, Rockland Immunochemicals

Catalog Number: (76236-756)
Supplier: Rockland Immunochemical
Description: Human NGF - NGF beta AccuSignal ELISA Kit
Image Unavailable-76236-758

Mouse NGF - NGF beta ELISA Kit, Rockland Immunochemicals

Catalog Number: (76236-758)
Supplier: Rockland Immunochemical
Description: Mouse NGF - NGF beta AccuSignal ELISA Kit
Image Unavailable-102997-266

Human Beta-Amyloid (2-40)

Catalog Number: (102997-266)
Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-MSPP-781511006

Human Recombinant NGF-beta, ACF

Supplier: STEMCELL Technologies
Description: Nerve growth factor (NGF)-beta is a prototypical member of the neurotrophin family and has a role in the survival and growth of neural cells, regulating cell growth, promoting differentiation into neurons, and neuron migration. The beta subtype of NGF is biologically active in comparison to the alpha-2 and gamma-2 subtypes. NGF-beta in its secreted form can bind to tyrosine kinase A (trkA) receptor with high affinity and to p75 (NTR) with low affinity (Levi and Alemà; Sofroniew <i>et al.</i>). NGF has been shown to possess pro-inflammatory and pro-fibrogenic properties (Micera <i>et al.</i>). It has also been shown that overexpression of NGF-beta promotes differentiation of bone marrow mesenchymal stem cells into neurons through regulation of AKT and MAPK pathways (Yuan <i>et al.</i>). This product is animal component-free.

New Product

Image Unavailable-103007-584

Human Beta-Amyloid (1-12)

Catalog Number: (103007-584)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 12 fragment of the beta-amyloid peptide. This N-terminal sequence was used to develop the antibody BR88. An antiserum directed against this peptide stained numerous tangle-bearing cells and bodies, as well as the neuritic component of plaques and neuropil threads. It stained a large number of pyramid cells.
Sequence: DAEFRHDSGYEV
Molecular Weight: 1424.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-192

Human Beta-Amyloid (1-13)

Catalog Number: (103008-192)
Supplier: Anaspec Inc
Description: This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-10787-918

Mouse Recombinant NGF-beta (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Nerve growth factor beta (β-NGF) is a neurotrophic factor that is important for the development and maintenance of sensory and sympathetic neurons. β-NGF signals through the low affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase A (TrkA) to activate PI3K, Ras, and PLC signaling pathways. β-NGF is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse, and rat β-NGF proteins are cross-reactive.

Image Unavailable-102999-616

Human Cys-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103871-608

Human Recombinant NRG1 Beta 1 (from HEK293 Cells)

Catalog Number: (103871-608)
Supplier: ACROBIOSYSTEMS INC MS
Description: Human NRG1 Beta 1 Protein, Fc Tag, ACROBiosystems
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,505 - 1,520 of 25,884
no targeter for Bottom