You Searched For: Monomethyl+terephthalate


1,869  results were found

Sort Results

List View Easy View
SearchResultCount:"1869"
Description: Sequence: KKPYIL
MW: 761 Da
% peak area by HPLC: 95%
Storage condition: -20°C
Catalog Number: 102999-808
Supplier: Anaspec Inc


Description: This peptide is histone H3 (1-35).
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
MW:3551.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103009-474
Supplier: Anaspec Inc


Description: This is an integrin-binding peptide.
Sequence:GRGDTP
MW:601.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-340
Supplier: Anaspec Inc


Description: This antibody is predicted to react with bovine and rat based on sequence homology. Parkinson's disease (PD) is a multifactorial disease that appears to arise from the effects of both genetic and environmental influences. The known genetic factors include multiple genes that have been identified in related parkinsonian syndromes, as well as alpha-synuclein. Genes associated with either PD or Parkinson-related disorders include parkin, DJ-1, ubiquitin C-terminal hydrolase isozyme L1 (UCH-L1), nuclear receptor-related factor 1 (NURR1), and alpha-synuclein. Nurr1 is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. It belongs to the conserved family of nuclear receptors but lacks an identified ligand and is therefore referred to as an orphan receptor. RXR ligands can promote the survival of DA neurons via a process that depends on Nurr1-RXR heterodimers. In developing DA cells, Nurr1 is required for the expression of several genes important for DA synthesis and function. Nurr1 is also important for the maintenance of adult DA neurons.
Catalog Number: CAPIPA5-13416
Supplier: Thermo Scientific


Description: This is biotinylated Bradykinin peptide.
Sequence:Biotin-RPPGFSPFR
MW:1286.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102999-768
Supplier: Anaspec Inc


Description: This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-882
Supplier: Anaspec Inc


Description: This is a CGRP receptor antagonist.
Sequence:VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
MW:3125.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102999-366
Supplier: Anaspec Inc


Description: An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-336
Supplier: Anaspec Inc


Description: This peptide is a negative control for cGRGDSP
Sequence:Cyclo-[GRGESP]
MW:582 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-172
Supplier: Anaspec Inc


Description: This thrombin receptor agonist peptide is a PAR 1 antagonist peptide.
Sequence:FLLRN
MW:661.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103003-342
Supplier: Anaspec Inc


Description: This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-766
Supplier: Anaspec Inc


Description: This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-750
Supplier: Anaspec Inc


Description: This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).
Sequence:KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
MW:4771.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-682
Supplier: Anaspec Inc


Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGTGMKKTSFQRAKS
MW:2187.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-450
Supplier: Anaspec Inc


Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGSGAKKTSFRRAKQ
MW:2182.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-452
Supplier: Anaspec Inc


Description: A vesicular stomatitis virus G (VSV-G) protein fragment.
Sequence:YTDIEMNRLGK
MW:1339.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102998-830
Supplier: Anaspec Inc


193 - 208 of 1,869