Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-528

Bacterial Sortase Substrate III, DNP(2, 4-Dinitrophenol)

Catalog Number: (103007-528)
Supplier: Anaspec Inc
Description: The Staphylococcus aureus transpeptidase Sortase A (SrtA) anchors virulence and colonization-associated surface proteins to the cell wall. SrtA selectively recognizes a C-terminal LPXTG motif. SrtA readily reacts with its native substrate Abz-LPETG-Dap(DNP)-NH2, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this FRET substrate can be monitored at Ex/Em=320 nm/420 nm.
Sequence:Abz-LPETG-K(Dnp)-NH2
MW:928 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-252

CKS-17 (dimer)

Catalog Number: (103008-252)
Supplier: Anaspec Inc
Description: A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-216

Human [Lys22]-beta-Amyloid (1-42)

Catalog Number: (103007-216)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-610

Human Beta-Amyloid (11-42), HiLyte™ Fluor 488

Catalog Number: (103007-610)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-260

HIV TAT-NSF222 Fusion Peptide

Catalog Number: (103007-260)
Supplier: Anaspec Inc
Description: This sequence is N-ethyl-maleimide-sensitive factor (NSF) peptide connected to 11 amino acid cell permeable human immunodeficiency virus (HIV) transactivating regulatory protein (TAT) domain by Gly-Gly-Gly spacer. This peptide contains NSF domain extending from amino acids 222 to 243, which is directly amino-terminal of the Walker A motif of the D1 domain of NSF. ATPase assay shows that TAT-NSF222 inhibits NSF ATPase activity.
Sequence: YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE
MW: 4239.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103005-918

Gila Exendin 4, FAM-labeled, FAM (Carboxyfluorescein)

Catalog Number: (103005-918)
Supplier: Anaspec Inc
Description: This full length Exendin 4 amide peptide is labeled with a fluorescent dye (FAM), Abs/Em = 494/519 nm, on its N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4545 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-154

Integrin-Binding Site

Catalog Number: (103007-154)
Supplier: Anaspec Inc
Description: This RGD-containing sequence is integrin-binding site. RGD peptides are found in both extracellular matrix (ECM) (e.g., collagen, osteopontin, fibronectin, and vitronectin) and non-ECM proteins (e.g., disintegrins). RGD-containing peptides are recognized by several integrins. This peptide targets both alphavbeta3 and alpha5beta1 integrins. Interaction of the RGDN sequence with endothelial alpha5beta1 integrin causes endothelin-mediated arteriolar vasoconstriction. This peptide influences the IkappaB kinase (IKK)/nuclear factor-kappaB (NF-kappaB) activation. It also controls the cardiac contractile function.
Sequence:GRGDNP
MW:614.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-75844-144

Anti-CD45.1 Mouse Monoclonal Antibody (PerCP (Peridinin-Chlorophyll Protein Complex)-Cy5.5®) [clone: A20]

Catalog Number: (75844-144)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Image Unavailable-75844-148

Anti-CD45.1 Mouse Monoclonal Antibody (PE (Phycoerythrin)-Cy7®) [clone: A20]

Catalog Number: (75844-148)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Image Unavailable-75844-136

Anti-CD45.1 Mouse Monoclonal Antibody (FITC (Fluorescein Isothiocyanate)) [clone: A20]

Catalog Number: (75844-136)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Image Unavailable-75844-154

Anti-CD45.1 Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: A20]

Catalog Number: (75844-154)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Image Unavailable-75844-140

Anti-CD45.1 Mouse Monoclonal Antibody (PE (Phycoerythrin)) [clone: A20]

Catalog Number: (75844-140)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Image Unavailable-75844-142

Anti-CD45.1 Mouse Monoclonal Antibody (PE (Phycoerythrin)) [clone: A20]

Catalog Number: (75844-142)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.
Product Image-10075-704

Anti-PPP1R1B Rabbit Polyclonal Antibody

Catalog Number: (10075-704)
Supplier: Prosci
Description: DARPP-32 is a dopamine (DA) and cAMP-regulated ~32k phosphoprotein that is associated with dopaminoceptive neurons (Fienberg et al., 1998). The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA (Bibb et al., 1999). Phosphorylation of DARPP-32 is thought to play a critical role in the regulation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles
in the actions of alcohol, caffeine and Prozac® (Maldve et al., 2002; Lindskog et al., 2002; Svenningsson et al., 2002).
Image Unavailable-102998-832

Influenza HA peptide

Supplier: Anaspec Inc
Description: This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-102998-454

salmon Calcitonin, salmon

Catalog Number: (102998-454)
Supplier: Anaspec Inc
Description: A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
929 - 944 of 1,860
no targeter for Bottom