Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Product Image-10091-490

Anti-NURR Rabbit Polyclonal Antibody

Catalog Number: (10091-490)
Supplier: Proteintech
Description: NR4A2 belongs to the orphan nuclear receptor (NR) family referred to as NR4A family, which have been implicated in cell cycle regulation, apoptosis, inflammation, metabolism and more recently in carcinogenesis . NR4A2 also has a role in the expression of several proteins that are necessary for the synthesis and regulation of dopamine (DA), such as tyrosine hidroxilase, dopamine transporter, vesicular monoamine transporter 2, and cRET . Act as a transcriptional regulator, NR4A2 is essential for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons .
Image Unavailable-103007-526

Human Beta-Amyloid (3-42)

Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103007-254

Bacterial Sortase Substrate I

Catalog Number: (103007-254)
Supplier: Anaspec Inc
Description: This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-080

Pannexin-1 Blocking Peptide

Catalog Number: (103007-080)
Supplier: Anaspec Inc
Description: This is a Pannexin-1 (Panx1) mimetic blocking peptide. Pannexin-1 is a recently identified membrane protein that can form gap junction-like connections allowing intercellular passage of dyes when overexpressed in two adjacent oocytes or mammalian epithelial cell lines. Blockade of pannexin-1 in macrophage endogenously expressing the ATP-gated P2X7 receptor (P2X7R) blocks the initial dye uptake, but not the ionic current, and also blocks processing and release of interleukin-1beta (IL-1beta) in response to P2X7R activation.
Sequence:WRQAAFVDSY
MW:1242.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-472

Pig Protegrine-1 (PG-1)

Catalog Number: (103008-472)
Supplier: Anaspec Inc
Description: This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-748

Human Beta-Amyloid (11-17)

Catalog Number: (103007-748)
Supplier: Anaspec Inc
Description: This is a short fragment of the b-Amyloid peptide containing Histidine 13 and 14. Alzheimer’s beta amyloid peptides form A? ion channels in lipid bilayers. It is postulated that ion channel activity of A? is related to cytotoxic activity of A?. Small peptides that contain the amino acid sequence of the predicted mouth region of the A? channel pore can inhibit A? ion channel activity. And, Histidines 13 and 14 have been shown to be essential for the peptide to inhibit Alzheimer’s disease A? ion channel and cytotoxicity.
Sequence: EVHHQKL
Molecular Weight: 890 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102996-098

Human Fibrinopeptide A

Catalog Number: (102996-098)
Supplier: Anaspec Inc
Description: Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino acid peptide, fibrinopeptide B, uncovers the E domain of fibrinogen. The residual protein, fibrin monomer, polymerizes to form fibrin clot. Thus, liberation of approximately 4 ng/ml of FPA per milligram of fibrinogen is closely linked to clot formation. Elevation of Fibrinopeptide A levels in plasma is seen in association with disorders such as disseminated intravascular coagulation, deep venous thrombosis, arterial thrombosis, and malignancy.
Sequence:ADSGEGDFLAEGGGVR
MW:1536.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103002-744

EMP17, FITC-LC labeled, FITC (Fluorescein Isothiocyanate)

Catalog Number: (103002-744)
Supplier: Anaspec Inc
Description: This is a fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: FITC-LC-TYSCHFGPLTWVCKPQGG
MW: 2483.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-506

Histone H3 (1-20)

Catalog Number: (103007-506)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 20 fragment of the histone H3. Comparison the acetylation efficiency of different substrates showed that this peptide corresponding to the N-terminal of H3 histone has nearly identical acetylation efficiency as the H4 peptides. Acetylation of histones is generally associated with active transcription, constitutes a post-translational mark recognized by specific chromatin factors, and has been shown in vitro to prevent salt-induced folding of nucleosome arrays. Multisubunit histone acetyltransferase (HAT) complexes recognize and perform efficient acetylation on nucleosome substrates.
Sequence:ARTKQTARKSTGGKAPRKQL
MW:2183.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-528

Bacterial Sortase Substrate III, DNP(2, 4-Dinitrophenol)

Catalog Number: (103007-528)
Supplier: Anaspec Inc
Description: The Staphylococcus aureus transpeptidase Sortase A (SrtA) anchors virulence and colonization-associated surface proteins to the cell wall. SrtA selectively recognizes a C-terminal LPXTG motif. SrtA readily reacts with its native substrate Abz-LPETG-Dap(DNP)-NH2, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this FRET substrate can be monitored at Ex/Em=320 nm/420 nm.
Sequence:Abz-LPETG-K(Dnp)-NH2
MW:928 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-260

HIV TAT-NSF222 Fusion Peptide

Catalog Number: (103007-260)
Supplier: Anaspec Inc
Description: This sequence is N-ethyl-maleimide-sensitive factor (NSF) peptide connected to 11 amino acid cell permeable human immunodeficiency virus (HIV) transactivating regulatory protein (TAT) domain by Gly-Gly-Gly spacer. This peptide contains NSF domain extending from amino acids 222 to 243, which is directly amino-terminal of the Walker A motif of the D1 domain of NSF. ATPase assay shows that TAT-NSF222 inhibits NSF ATPase activity.
Sequence: YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE
MW: 4239.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-668

[Lys(Ac)16]-Histone H4 (1-20)

Catalog Number: (103007-668)
Supplier: Anaspec Inc
Description: This Histone 4 peptide is acetylated at lysine 16. Lysine 16 of H4 appears to be a unique target for acetylation. Studies in yeast clearly indicate that acetylation of H4 lysine 16 is an independent specific function in relation to gene transcription when compared to other histone acetylation sites. It was also observed that a human histone acetyltransferase complex showed strong specificity for H4K16 in chromatin and, RNAi-mediated knockdown experiments revealed that it is responsible for the majority of H4 acetylation at lysine 16 in the cell.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-264

Human Beta-Amyloid (3-40)

Catalog Number: (103006-264)
Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103005-918

Gila Exendin 4, FAM-labeled, FAM (Carboxyfluorescein)

Catalog Number: (103005-918)
Supplier: Anaspec Inc
Description: This full length Exendin 4 amide peptide is labeled with a fluorescent dye (FAM), Abs/Em = 494/519 nm, on its N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4545 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102996-480

Human Beta-Amyloid (12-28)

Supplier: Anaspec Inc
Description: Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103007-222

LyP-1, Peptide 1

Catalog Number: (103007-222)
Supplier: Anaspec Inc
Description: LyP-1 recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues. Screening on breast carcinoma xenografts shows positive to cyclic 9-amino-acid peptide, LyP-1. The LyP-1 also recognizes an osteosarcoma xenograft, and spontaneous prostate and breast cancers in transgenic mice. LyP-1 peptide is detected in tumor structures that are positive for several lymphatic endothelial markers and negative for blood vessel markers. LyP-1 accumulates in the nuclei of the putative lymphatic cells, and in the nuclei of tumor cells.
Sequence:CGNKRTRGC (S-S Bonded)
MW:992.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
897 - 912 of 1,860
no targeter for Bottom