Print…

You Searched For: ZnAF-1+DA


1,840  results were found

Refine Results Sort by
SearchResultCount:"1840"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-102996-488

Human Beta-Amyloid (1-28)

Supplier: Anaspec Inc
Description: Aß (1-28) is highly hydrophilic and shares sequences with bA4, the major component of Aß. Its assembly is fibrillar, i.e., elongated in a single direction. Reports show that synthetic peptides Aß (1-40) and Aß (1-28) have significant effects on normal human plasma cholesterol esterification rate.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK
Molecular Weight: 3262.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103007-274

Noxa BH3, Peptide 1

Catalog Number: (103007-274)
Supplier: Anaspec Inc
Description: This peptide belongs to the Bcl-2 family of proteins. Noxa gene encodes a Bcl-2 homology 3 (BH3)-only member of this family; it contains the BH3 region, not other BH domains. When ectopically expressed, Noxa undergoes BH3 motif-dependent localization to mitochondria, it interacts with anti-apoptotic Bcl-2 family members resulting in the activation of caspase-9.
Sequence:PAELEVECATQLRRFGDKLNFRQKLL
MW:3075.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-CAPIM807

Anti-EGF Mouse Monoclonal Antibody [clone: 9A1]

Catalog Number: (CAPIM807)
Supplier: Thermo Scientific
Description: The M807 anti-EGF antibody has successfully been paired as the detection antibody in a sandwich ELISA with coating antibody MA805 (Clone 1H11). Typical dilutions for sandwich ELISA: Coat = 1-3 µg/ml and Detection = 0.125-0.5 µg/ml. The protein encoded by EGF gene is a growth factor that stimulates cell growth, proliferation, and differentiation by binding to its receptor EGFR. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds.
Image Unavailable-103003-154

Human Adrenomedullin (1-52)

Catalog Number: (103003-154)
Supplier: Anaspec Inc
Description: Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-996

[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: (103007-996)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 21 phosphorylated at Ser-10 and acetylated at Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2845.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-926

WAAG-3R,DNP(2,4-Dinitrophenol)

Catalog Number: (103005-926)
Supplier: Anaspec Inc
Description: Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103004-434

EGF Receptor Substrate 2 [DADE-pY-LIPQQG]

Catalog Number: (103004-434)
Supplier: Anaspec Inc
Description: The unlabeled phosphopeptide is an excellent substrate for mammalian protein tyrosine phosphatase 1B (Km = 3.9 µM) and Yersinia PTP. The sequence is derived from an autophosphorylation site (Tyr992) of EGFR. The unlabeled peptide is used to assay PTB based on marked fluorescence increase upon the removal of the phosphate group (Em = 305 nm and Ex = 282 nm).
Sequence:Biotin-DADE-pY-LIPQQG
MW:1556.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103002-968

Human Beta-Amyloid (9-42)

Catalog Number: (103002-968)
Supplier: Anaspec Inc
Description: Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-076

Renin 520 Peptide

Catalog Number: (103007-076)
Supplier: Anaspec Inc
Description: This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103005-914

Gila Biotin-Exendin 4,Biotin

Supplier: Anaspec Inc
Description: This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103006-582

Human MUC5AC-13

Catalog Number: (103006-582)
Supplier: Anaspec Inc
Description: This glycopeptide is an N-acetyl galactosamine (GalNAc)-modified MUC5AC mucin peptide containing the single site of threonine 13 labeled with GalNAc (T*). Polypeptide N-acetylgalactosaminyltransferase (ppGaNTase) catalyzes the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to threonine. The MUC5AC gene is mainly expressed in gastric and tracheo-bronchial mucosae, and some tumors.
Sequence:GTTPSPVPTTST-T*-SAP (* = GalNAc-modified residue)
MW:1704.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-364

Human hBD-1

Catalog Number: (103003-364)
Supplier: Anaspec Inc
Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-774

Dynorphin A (1-17),Biotin

Catalog Number: (102999-774)
Supplier: Anaspec Inc
Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:Biotin-YGGFLRRIRPKLKWDNQ
MW:2373.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-792

S. pneumoniae Competence-Stimulating Peptide-2

Catalog Number: (103007-792)
Supplier: Anaspec Inc
Description: Genetic transformation in Streptococcus pneumoniae, Streptococcus mitis and Streptococcus oralis is regulated by secreted peptide pheromones named the competence-stimulating peptide (CSP). Different strains and species of these bacteria produce CSP with different primary sequence. They are termed pheromones CSP-1 (EMRLSKFFRDFILQRKK), CSP-2 (EMRISRIILDFLFLRKK), CSP-153 (DKRLPYFFKHLFSNRTK), CSP-612 (ESRLSRLLRDFIFQIKQ), CSP-676 (ERRIPDVIRSLLFQKRK), and CSP-12261 (EIRQTHNIFFNFFKRR).
Sequence:EMRISRIILDFLFLRKK
MW:2178.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-256

4N1K, AnaSpec

Catalog Number: (103008-256)
Supplier: Anaspec Inc
Description: 4N1K is a cell-binding domain adhesive peptide. It has been identified as an IAP agonist. Integrin-associated protein (IAP) is important in host defense where it is required for integrin-dependent functions of polymorphonuclear leukocytes. IAP also appears to be important in modulating integrin function in other cells and in signal transduction upon ligand binding by certain integrins with which it associates.
Sequence:KRFYVVMWKK
MW:1384.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
737 - 752 of 1,840
no targeter for Bottom