Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103006-426

HIV TAT Cys(Npys)

Catalog Number: (103006-426)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-NH2
MW: 1816.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-602

Human [Arg6]-beta-Amyloid (1-40)

Catalog Number: (103007-602)
Supplier: Anaspec Inc
Description: Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-290

Rat Renin FRET Substrate

Catalog Number: (103007-290)
Supplier: Anaspec Inc
Description: This renin FRET peptide is a specific substrate for rat renin. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by rat renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. The SensoLyte® 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-086

Human Parathyroid Hormone (1-34), Biotinylated, Biotin

Catalog Number: (102996-086)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-426

TNF-alpha Antagonist

Catalog Number: (103007-426)
Supplier: Anaspec Inc
Description: This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-112

[Lys(Me3)4]-Histone H3 (1-25)

Catalog Number: (103008-112)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to amino acids 1-25 of human histone H3. It is trimethylated at lysine 4. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2
MW:2667.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: (103008-536)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-358

[Arg(Me1)3]-Histone H4 (1-23)-GGK,Biotin

Catalog Number: (103009-358)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-23) monomethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me1)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2843.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-154

Human Adrenomedullin (1-52)

Catalog Number: (103003-154)
Supplier: Anaspec Inc
Description: Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103003-370

Human HNP-1 Peptide

Catalog Number: (103003-370)
Supplier: Anaspec Inc
Description: Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Sequence:ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
MW:3442.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-718

BDC2.5 Mimotope

Catalog Number: (103007-718)
Supplier: Anaspec Inc
Description: The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet beta cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.
Sequence: RTRPLWVRME
MW: 1343.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-258

HIV TAT-NSF700 Fusion Peptide

Catalog Number: (103007-258)
Supplier: Anaspec Inc
Description: This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
MW: 4167 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-500

Human PLP

Catalog Number: (103007-500)
Supplier: Anaspec Inc
Description: This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.
Sequence: NTWTTCQSIAFPSK
MW: 1583.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103005-926

WAAG-3R,DNP(2,4-Dinitrophenol)

Catalog Number: (103005-926)
Supplier: Anaspec Inc
Description: Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-404

Substance P, FAM (Carboxyfluorescein)

Catalog Number: (103006-404)
Supplier: Anaspec Inc
Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-420

Caloxin 3A1

Catalog Number: (103007-420)
Supplier: Anaspec Inc
Description: This peptide belongs to caloxins, the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP. Related peptides: Caloxin 1A1 (cat# 62605) and Caloxin 2A1 (cat# 62604).
Sequence:WSSTSSVSAPLEFGGGGSAK
MW:1912.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
721 - 736 of 1,860
no targeter for Bottom