Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103006-354

Cyclo (-RGDfK)

Catalog Number: (103006-354)
Supplier: Anaspec Inc
Description: In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to alpha-v/beta-3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence.
Sequence:Cyclo(-RGDfK)
MW:603.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-482

Buforin

Catalog Number: (103006-482)
Supplier: Anaspec Inc
Description: This antimicrobial peptide interacts with phospholipid bilayers and can be efficiently translocated accross the layer with a weak membrane permeabilization activity. The proline hinge in Buforin 2 is responsible for these cell penetrating properties. This class of antibacterial peptides therefore targets intracellular molecules, most probably nucleic acids, without significantly permeting cell membranes.
Sequence:TRSSRAGLQFPVGRVHRLLRK
MW:2434.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-858

Human Beta-Amyloid (10-20)

Catalog Number: (102999-858)
Supplier: Anaspec Inc
Description: A number of Aß fragments including Aß (10-20) enhances aggregation of Aß (1-40). All the Aß peptides that enhance aggregation contain either residues 17 to 20 or 30 to 35, indicating the importance of these regions for promoting aggregation of full-length Aß.
Sequence: YEVHHQKLVFF
Molecular Weight: 1446.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-364

Mouse;Rat Beta-Amyloid (1-38)

Catalog Number: (103007-364)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-994

[Lys(Ac)9/14]-Histone H3 (1-21)-GGK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-9 and Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2807.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103007-560

Human Protease Activated Receptor 3

Catalog Number: (103007-560)
Supplier: Anaspec Inc
Description: This peptide is one of the four PAR sub-types, and is acted upon by thrombin; not trypsin. It is a high-affinity thrombin receptor. PAR-3 mRNA is expressed in the cutaneous mast cells of humans. Co-expression of PAR3 and PAR4 enhances thrombin action suggesting that PAR3 alone does not mediate transmembrane signaling but instead functions as a cofactor to activate PAR4.
Sequence: SFNGGP-NH2
MW: 576.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103008-598

Plasmodium Plasmepsin V FRET Substrate, DABCYL-EDANS

Catalog Number: (103008-598)
Supplier: Anaspec Inc
Description: This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.
Sequence:Dabcyl-LNKRLLHETQ-EDANS
MW:1751.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-558

Human Protease Activated Receptor 1

Catalog Number: (103007-558)
Supplier: Anaspec Inc
Description: This proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptors and is known to mediate the cellular effects of thrombin. In addition to it's varied cellular effects of thrombin, PAR-1 also has been shown to co-ordinate with PAR-4 and regulate thrombin-induced hepatocellular carcinoma harboring thrombin formation within the tumor environment classified as 'coagulation type'.
Sequence: TFLLRN-NH2
MW: 761.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103006-888

Rat Uroguanylin

Catalog Number: (103006-888)
Supplier: Anaspec Inc
Description: Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-680

Rat C-Peptide-1

Catalog Number: (103007-680)
Supplier: Anaspec Inc
Description: This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-172

Transdermal Peptide

Catalog Number: (103007-172)
Supplier: Anaspec Inc
Description: This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-388

Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103006-116

Rat;Mouse [Des-octanoyl]-Ghrelin

Catalog Number: (103006-116)
Supplier: Anaspec Inc
Description: Des-octanoyl (or Des-acyl) Ghrelin is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPR
MW: 3188.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103006-386

Human [Des-octanoyl]-Ghrelin

Catalog Number: (103006-386)
Supplier: Anaspec Inc
Description: Des-octanoyl (or Des-acyl) Ghrelin, DAG, is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPR
MW: 3244.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-330

Influenza Virus Nucleoprotein (311-325)

Catalog Number: (103007-330)
Supplier: Anaspec Inc
Description: This peptide is amino acids 311 to 325 fragment of the influenza virus nucleoprotein (NP). This bona fide MHC class II restricted epitope from influenza virus was used to study the host immunoresponse during the infection. This peptide elicits the strongest gamma interferon (IFN-gamma) production in the intracellular cytokine assays. It does not stimulate CD8 T-cells in mice.
Sequence:QVYSLIRPNENPAHK
MW:1767 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-518

Human LL-37 fragment (18-37)

Catalog Number: (103007-518)
Supplier: Anaspec Inc
Description: This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
673 - 688 of 1,860
no targeter for Bottom