Print…

You Searched For: ZnAF-1+DA


1,869  results were found

Refine Results Sort by
SearchResultCount:"1869"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-044

Human Beta-Amyloid (1-36)

Catalog Number: (103003-044)
Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Molecular Weight: 4017.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-590

Autocamtide-3-Related Inhibitory Peptide

Catalog Number: (103008-590)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-820

(Arg)9,Biotin

Catalog Number: (103007-820)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This peptide sequence with nine arginines contains a biotin group attached to the epsilon amino group of lysine at the N-terminus.
Sequence:Biotin-LC-RRRRRRRRR-NH2
MW:1762.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-152

Apidaecin IB

Catalog Number: (103007-152)
Supplier: Anaspec Inc
Description: Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, but is devoid of any pore-forming activity. Apidaecins are the most prominent components of the honey bee humoral defense against microbial invasion.
Sequence:GNNRPVYIPQPRPPHPRL
MW:2108.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-120

Human;Mouse;Rat Beta-Amyloid (25-35)

Catalog Number: (103007-120)
Supplier: Anaspec Inc
Description: This is the scrambled beta-Amyloid peptide amino acids 25 to 35. Pairing this peptide with the native b-Amyloid 25 to 35 amino acids peptide has been used to recognize its structure and functions.
Sequence: MAKGINGISGL
Molecular Weight: 1060.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103009-058

[Lys(Ac)20]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: (103009-058)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-25) with acetylation at Lys20. It is biotinylated through a C-terminal GSGSK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-752

W Peptide

Catalog Number: (102996-752)
Supplier: Anaspec Inc
Description: This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102997-486

AKT/PKB/Rac-Protein Kinase Substrate, AnaSpec

Supplier: Anaspec Inc
Description: The native peptide ARKRERTYSFGHHA (29944-1) is a synthetic substrate for AKT/PKB/Rac-protein kinases. Phophorylation is at the Ser site (Km = 3.9 µM). It also competitively inhibits histone H2B phosphorylation (Ki = 12 µM) by AKT.
Sequence:Biotin-ARKRERTYSFGHHA
MW:1942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103003-714

Human;Rat Corticotropin Releasing Factor, CRF

Catalog Number: (103003-714)
Supplier: Anaspec Inc
Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103006-940

Renin 390 FRET Substrate I

Catalog Number: (103006-940)
Supplier: Anaspec Inc
Description: This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS), acting through type 1 angiotensin (AT1) receptors, is a master regulator of fluid homeostasis.
Sequence:R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
MW:2282.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-462

ClearPoint™ Human Ang II Isotope Labeled

Catalog Number: (103008-462)
Supplier: Anaspec Inc
Description: The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed through cleavage of Ang I by the angiotensin-conve
Sequence: DRVY-I*-HPF [I*= I(U13C6,15N)]
MW: 1053.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103008-588

Autocamtide-2-Related Inhibitory Peptide

Catalog Number: (103008-588)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-2-Related Inhibitory Peptide (AIP), a highly potent and specific substrate competitive inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII). AIP is derived from Autocamtide-2, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALRRQEAVDAL
MW:1708.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-614

Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-614)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103003-716

Hexa His

Supplier: Anaspec Inc
Description: This is a hexapeptide with 6 histidines primarily used in tagging proteins. His tags have been used in affinity purification of recombinant proteins and have also been used in studying protein transduction in cells with the use of cell-penetrating proteins/peptides.
Sequence:HHHHHH
MW:841.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-450

BMP-2 Knuckle Epitope (73-92)

Catalog Number: (103008-450)
Supplier: Anaspec Inc
Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-186

Hen HEL (46-61)

Catalog Number: (103003-186)
Supplier: Anaspec Inc
Description: This peptide is amino acids 46 to 61 fragment of the hen egg lysozyme (HEL). Lysozyme is anti-bacterial enzyme found in high concentration in the egg white. HEL was used in MHC related studies, and tested as a part of antimicrobial vaccines.
Sequence:NTDGSTDYGILQINSR
MW:1753.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
497 - 512 of 1,869
no targeter for Bottom