Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-710

Caerulein

Catalog Number: (103003-710)
Supplier: Anaspec Inc
Description: Caerulein, a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary, and pancreatic secretion. Caerulein injections cause acute pancreatitis in mice.
Sequence: Pyr-QD-Y(SO3H)-TGWMDF-NH2
MW: 1352.4 Da
% Peak area by HPLC: 95
Storage condition:
Image Unavailable-103008-216

Human [Met]-beta-Amyloid (1-42), TAMRA (5-Carboxytetramethylrhodamin)

Catalog Number: (103008-216)
Supplier: Anaspec Inc
Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103003-274

Human TET 830 Modified

Catalog Number: (103003-274)
Supplier: Anaspec Inc
Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-612

[Lys(Me2)20]-Histone H4 (8-30)- WGK,Biotin

Catalog Number: (103009-612)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-914

Histone H3 (1-25)

Catalog Number: (103006-914)
Supplier: Anaspec Inc
Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-796

Mouse Laminin alpha1 (2110-2127)

Catalog Number: (103007-796)
Supplier: Anaspec Inc
Description: This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-696

[Arg(Me2s)3] - Histone H4 (1-21) - GGK,Biotin

Catalog Number: (103009-696)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 1-21 with a C-terminal GG linker followed by a biotinylated lysine. Arginine 3 is dimethylated symmetrically.
Sequence:Ac-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103000-576

HIV TAT (47-57) FITC LC Peptide, FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc
Description: This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Image Unavailable-103005-328

RGD-4C

Catalog Number: (103005-328)
Supplier: Anaspec Inc
Description: This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-692

Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 488

Catalog Number: (103010-692)
Supplier: Anaspec Inc
Description: Protein A-HiLyte™ Fluor 488 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (green) Excitation/Emission wavelength: 499 nm/523 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development
Image Unavailable-103006-408

Cys(Npys)-(Arg)9

Catalog Number: (103006-408)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-082

Human Ang II FAM Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103003-082)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Angiotensin II peptide, Abs/Em=494/518 nm. FAM (carboxyfluorescein) exhibits better chemical and photo-stability than FITC.
Sequence: FAM-DRVYIHPF
MW: 1404.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103006-286

Mouse Uty HY Peptide (246-254)

Catalog Number: (103006-286)
Supplier: Anaspec Inc
Description: This T-cell epitope WMHHNMDLI is a male-specific transplantation antigen, H-Y, derived from mouse UTY (ubiquitously transcribed tetratricopeptide repeat gene on the Y chromosome) protein. It is presented by H2-Db
Sequence:WMHHNMDLI
MW:1196.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-102

Human Cholecystokinin (26-33), CCK8

Catalog Number: (102996-102)
Supplier: Anaspec Inc
Description: A non-sulfated CCK Octapeptide. Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: DYMGWMDF-NH2
MW: 1063.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102996-548

[Leu5]-Enkephalin

Catalog Number: (102996-548)
Supplier: Anaspec Inc
Description: Enkephalins are pentapeptides involved in regulating nociception in the body. There are two enkephalin forms, one containing leucine and the other containing methionine ("met"). Both are products of the proenkephalin gene.
Sequence:YGGFL
MW:555.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-232

Interphotoreceptor Retinoid Binding Protein Fragment Peptide

Catalog Number: (103008-232)
Supplier: Anaspec Inc
Description: R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
353 - 368 of 1,860
no targeter for Bottom