You Searched For: HONEYWELL+BURDICK


2,287  results were found

SearchResultCount:"2287"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (77751-166)
Supplier: VWR International

New Product


Catalog Number: (77751-168)
Supplier: VWR International

New Product


Catalog Number: (77751-170)
Supplier: VWR International

New Product


Catalog Number: (77660-772)
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Human Recombinant IL-34 (from CHO cells)

New Product


Catalog Number: (77660-776)
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Human Recombinant IL-34 (from CHO cells)

New Product


Catalog Number: (77660-770)
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Human Recombinant IL-34 (from CHO cells)

New Product


Catalog Number: (77660-774)
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Human Recombinant IL-34 (from CHO cells)

New Product


Catalog Number: (MSPP-100-0930)
Supplier: STEMCELL Technologies
Description: Human Recombinant IL-34, His tag

New Product


Catalog Number: (H-6630.1000BA)
Supplier: Bachem Americas
Description: 1mg V.Paspaliaris et al. showed that daily administration of pTHrP (1-34) to rats was anabolic on bone by increasing bone formation. This treatment could inhibit the rapid decline in bone formation due to denervation. CAS: 112540-82-6 C180H287N57O48 FW: 4017.61 . Synonym: Hypercalcemia of Malignancy Factor (1-34) (human, mouse, rat), pTHrP (1-34) (human, mouse, rat)


Catalog Number: (H-6630.0500BA)
Supplier: Bachem Americas
Description: 0.5mg V.Paspaliaris et al. showed that daily administration of pTHrP (1-34) to rats was anabolic on bone by increasing bone formation. This treatment could inhibit the rapid decline in bone formation due to denervation. CAS: 112540-82-6 C180H287N57O48 FW: 4017.61 . Synonym: Hypercalcemia of Malignancy Factor (1-34) (human, mouse, rat), pTHrP (1-34) (human, mouse, rat)


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid Hormone (1-34), human, Purity: HPLC >/= to 95%, Molecular Weight: 4117.8, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVF, Appearance: Lyophilized white powder, regulates the metabolism of calcium and phosphate, Storage: -20 deg C, Size: 1 mg


Catalog Number: (H-5460.0500BA)
Supplier: Bachem Americas
Description: 0.5mg Rat pTH (1-34) suppressed appositional bone formation by cultured rat cranial osteoblasts. CAS: 98614-76-7 C180H291N55O48S2 FW: 4057.76 . pTH


Catalog Number: (H-5460.1000BA)
Supplier: Bachem Americas
Description: 1mg Rat pTH (1-34) suppressed appositional bone formation by cultured rat cranial osteoblasts. CAS: 98614-76-7 C180H291N55O48S2 FW: 4057.76 . pTH


Catalog Number: (H-7234.1000BA)
Supplier: Bachem Americas
Description: ([13C6]Leu15)-pTH (1-34) (human) H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-13C6]Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Trifluoroacetate salt 1mg, Synonym: ([13C6]Leu15)-Teriparatide.


Catalog Number: (H-7234.0500BA)
Supplier: Bachem Americas
Description: ([13C6]Leu15)-pTH (1-34) (human) H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-13C6]Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Trifluoroacetate salt 0. 5mg, Synonym: ([13C6]Leu15)-Teriparatide.


Catalog Number: (10779-860)
Supplier: Peprotech
Description: Recombinant Human IL-34 Animal Free, 52.5 kDa homodimeric glycoprotein consisting of 460 amino acid residues, including a C-terminal His-Tag, Source: HEK293 cells, Cross Reactivity: Human, >95%, Synonyms: Interleukin-34, C16orf77, 250UG

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,201 - 1,216 of 2,287
no targeter for Bottom