You Searched For: Calcium


111,578  results were found

SearchResultCount:"111578"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10666-082)
Supplier: Bioss
Description: The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].


Catalog Number: (89164-088)
Supplier: Enzo Life Sciences
Description: Isolated from human plasma as prothrombin, and activated with Factor Xa, Factor Va, phospholipids, and calcium to yield a-thrombin.


Catalog Number: (CA11277-358)
Supplier: Mettler Toledo
Description: Membrane Kit, for Calcium ISE, DX series ISE half-cells, Mount the new membrane onto the shaft of your ISE half-cell, Precise determinations, Replaceable membranes for an optimal ion measurement


Catalog Number: (75788-588)
Supplier: Prosci
Description: Visinin-Like Protein 1 (VILIP) is a a member of the Visinin/Recoverin subfamily of neuronal calcium sensor proteins. VILIP is strongly expressed in the Granule Cells of the Cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of Adenylyl Cyclase. It has been shown that VILIP regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner in vitro.


Catalog Number: (89358-366)
Supplier: Genetex
Description: Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis. [provided by RefSeq]


Catalog Number: (89319-856)
Supplier: Genetex
Description: Rabbit polyclonal antibody to CAMKIV (calcium/calmodulin-dependent protein kinase IV)


Catalog Number: (77180-818)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S100A13/7483] antibody to S100 Calcium Binding Protein A13 / S100A13 for IHC-P with samples derived from Human.


Catalog Number: (77180-820)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S100A13/7484] antibody to S100 Calcium Binding Protein A13 / S100A13 for IHC-P with samples derived from Human.


Catalog Number: (89359-676)
Supplier: Genetex
Description: Osteocalcin belongs to the osteocalcin / matrix Gla-protein family and constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.


Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Catalog Number: (10168-080)
Supplier: Genetex
Description: Mouse Monoclonal antibody [20A] to Cav alpha 2/delta 1


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (76083-972)
Supplier: Bioss
Description: PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity.


Catalog Number: (89319-850)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)


Catalog Number: (76085-120)
Supplier: Bioss
Description: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).


Catalog Number: (76085-122)
Supplier: Bioss
Description: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
785 - 800 of 111,578
no targeter for Bottom