You Searched For: AGILENT TECHNOLOGIES, INC (CSD)

Description: Human Beta-Amyloid (11-25)

Catalog Number: 103007-538

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (11-42)

Catalog Number: 103007-598

Supplier: Anaspec Inc

Sale

Description: 5-FAM-PMDM6 (PMDM6-F), Sequence: 5-FAM-(B-A)-(B-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2, Purity: By HPLC greater than or equal to 95%, PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay, Molecular Weight: 1784.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-616

Supplier: Anaspec Inc

Sale

Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-586

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: 103008-536

Supplier: Anaspec Inc

Sale

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-412

Supplier: Anaspec Inc

Sale

Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-498

Supplier: Anaspec Inc

Sale

Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-804

Supplier: Anaspec Inc

Sale

Description: P70 S6 Kinase Substrate, Sequence: KKRNRTLTV, Purity: By HPLC greater than or equal to 95%, This peptide is a substrate for p70 ribosomal S6 kinase, Molecular Weight: 1115.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-790

Supplier: Anaspec Inc

Sale

Description: gp91 ds-tat, Sequence: YGRKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide, Molecular Weight: 2673.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-746

Supplier: Anaspec Inc

Sale

Description: [pThr11]-Histone H3(1-21)-GGK(Biotin), H3pT11, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2802.2, Sequence: ARTKQTARKS-pT-GGKAPRKQLAGG-K(Biotin)-NH2, Label: Biotin, histone H3 amino acid 1-21, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-620

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-104

Supplier: Anaspec Inc

Sale

Description: Colivelin

Catalog Number: 103007-098

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40) Binding Peptide,Biotin

Catalog Number: 103007-334

Supplier: Anaspec Inc

Sale

Description: Caloxin 2A1

Catalog Number: 103007-418

Supplier: Anaspec Inc

Sale

Description: Glutamate Receptor Endocytosis Inhibitor, GluR23Y, Sequence: YKEGYNVYG, Purity: By HPLC >/= 95%, used in ELISA cell-surface assay for insulin-stimulated endocytosis of native AMPA receptors, Molecular Weight: 1092.2, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-392

Supplier: Anaspec Inc

Sale