Print…

You Searched For: 6-Quinolinecarboxylic+acid


2,185  results were found

Refine Results Sort by
SearchResultCount:"2185"

Sort Results

List View Easy View

Rate These Search Results

Product Image-10085-512

Anti-CYP27A1 Rabbit Polyclonal Antibody

Catalog Number: (10085-512)
Supplier: Proteintech
Description: Mitochondrial sterol 27-hydroxylase (CYP27A1) catalyzes oxidative cleavage of the sterol side chain in the bile acid biosynthetic pathway in the liver and 27-hydroxylation of cholesterol in most tissues. It belongs to the cytochrome P450 family. CYP27A1 catalyses an important sterol elimination pathway in the macrophage, and consequently may protect against atherosclerosis.
Image Unavailable-77122-376

Anti-H2-D1 Mouse Monoclonal Antibody [clone: [27-11-13S]]

Catalog Number: (77122-376)
Supplier: Prosci
Description: Anti-H2-D1 Mouse Monoclonal Antibody [clone: [27-11-13S]]
Product Image-CAAG27-1030

CrossLab Reciprocating Dissolution Tubes, Agilent Technologies

Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Description: Several tube vessels are available for Apparatus 3 and 7.

Image Unavailable-CA80054-462

SIN-1 chloride, Calbiochem®

Catalog Number: (CA80054-462)
Supplier: MilliporeSigma
Description: Nitric oxide (NO) donor. Spontaneously decomposes to yield NO and superoxide anion radicals. Also inhibits release of plasminogen activator inhibitor (PAI) from stimulated platelets. CAS: 16142-27-1.FW: 206.7. Purity: >= 98% by TLC. Soluble in DMSO, ethanol and water. 20mg white solid.

Certificates


Image Unavailable-CA8.18407.0100

(R)-(+)-Limonene for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Cas Number 5989-27-5 For Synthesis

SDS Certificates

Image Unavailable-CAAAJ61978-AP

Naphthalene black 10B (naphthol blue black, acid black 1) 0.2% (v/v) in 5% acetic acid

Catalog Number: (CAAAJ61978-AP)
Supplier: Thermo Scientific Chemicals
Description: Liquid

Certificates


Image Unavailable-CA10763-624

Anti-IL-27 Rat Monoclonal Antibody [clone: J053B5]

Catalog Number: (CA10763-624)
Supplier: Biolegend
Description: Purified anti-IL-27/IL-35 EBI3 (monomer, dimer, heterodimer) [J053B5]; Isotype: Rat IgG2a; Reactivity: Mouse; Apps: WB; Size: 100 μg
Image Unavailable-77553-810

Human Recombinant ABL1 (M351T, GST tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (M351T) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag.

New Product

Image Unavailable-77553-812

Human Recombinant ABL1 (H396P, GST tag), Active (from Baculovirus-Insect Cells)

Supplier: Sino Biological
Description: Recombinant human ABL1 (H396P) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag.

New Product

Image Unavailable-76963-824

Anti-Integrin alpha 5 Rat Monoclonal Antibody [clone: 5H10-27 (MFR5)] (FITC (Fluorescein Isothiocyanate))

Catalog Number: (76963-824)
Supplier: ANTIBODIES.COM LLC
Description: Anti-Integrin alpha 5 Rat Monoclonal Antibody [clone: 5H10-27 (MFR5)] (FITC (Fluorescein Isothiocyanate))
Product Image-76196-376

VWR® Sterile Sample Bags

Catalog Number: (76196-376)
Supplier: Labplas
Description: These sample bags are ideal for transportation and storage of solids, semisolids, and liquids for environmental and carcass sampling, biomedical and pharmaceutical research, quality assurance procedures, food industry applications, and clinical and veterinary medicine.

Certificates


Product Image-76445-082

HALO® Glycan, BIOCLASS, HPLC Columns, Advanced Materials Technology

Supplier: Advanced Materials Technology
Description: HALO® Glycan incorporates a highly polar ligand that contains five hydroxyl groups tethered to 2.7 µm Fused-Core® silica particles via novel, proprietary linkage chemistry. Ideal for hydrophilic interaction liquid chromatography (HILIC) separations of oligosaccharides, and particularly, of released and labeled glycans from glycoproteins and proteoglycans.

Product Image-76443-656

HALO® C30, HPLC Columns, Advanced Materials Technology

Supplier: Advanced Materials Technology
Description: HALO® C30 columns made with innovative Fused-Core® particle technology for excellent reproducibility and column lifetimes provide fast, high-resolution separations. Available in 2.7 µm particle size and a wide range of column dimensions, HALO® 160 Å C30 columns are optimized for high performance in HPLC, UHPLC and LCMS small molecule applications.

Image Unavailable-77664-006

PTFE Coated Silver Wires

Supplier: WORLD PRECISION INSTRUMENTS LLC
Description: PTFE coated silver wire is available is precut lengths. It is design to reduce surface friction. Available in 36, 30, and 26 to 27 AWG.

New Product

Image Unavailable-102996-258

Human;Sheep;Rat PACAP (6-38), amide

Supplier: Anaspec Inc
Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-CA8.24510.0100

cis-Platin Pt 65% for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Cis-Platinum (65% Pt), CAS Number: 15663-27-1, Synonyms: cis-Diaminedichloroplatinum(II), cis-Dichlorodiamineplatinum(II), Chemical formula: cis-Pt(NH3)2Cl2.

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
241 - 256 of 2,185
no targeter for Bottom