You Searched For: Cyclohexyl+methyl+sulphide


1,243  results were found

SearchResultCount:"1243"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76099-082)
Supplier: Bioss


Catalog Number: (10086-108)
Supplier: Proteintech
Description: Anti-DR1 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-176 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower


Catalog Number: (76120-352)
Supplier: Bioss
Description: C4orf44, Polyclonal antibody, Host: Rabbit, Species: Human, mouse, rat, Isotype: IgG, Conjugate: AF750, Synonyms: C4orf44, Myb/SANT-like DNA-binding domain-containing protein 1, MSANTD1, Application: IHC-P, IF(IHC-P), Purity: Purified by Protein A, Size: 100 ul


Catalog Number: (76099-086)
Supplier: Bioss


Catalog Number: (76099-084)
Supplier: Bioss


Catalog Number: (76099-088)
Supplier: Bioss


Catalog Number: (10095-814)
Supplier: Proteintech
Description: Anti-TFAP2AAP-2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, C-term-353 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower


Catalog Number: (76107-878)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Application: WB, IHC-P, IF, Conjugate: Alexa Fluor 750, Concentration 1ug/ul, Purification: Purified by Protein A. Synonyms: EC 2.5.1.58; EC=2.5.1.58, Size: 100ul


Catalog Number: (10491-244)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Cy7 Conjugated, Isotype: IgG, Emmission/Excitation: 743nm/767nm, Application: IF(IHC-P), Synonymns: EC 2.5.1.58; EC=2.5.1.58, 100ul


Catalog Number: (10491-242)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Cy5.5 Conjugated, Isotype: IgG, Emmission/Excitation: 675nm/694nm, Application: IF(IHC-P), Synonymns: EC 2.5.1.58; EC=2.5.1.58, 100ul


Catalog Number: (10491-246)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,FITC Conjugated, Isotype: IgG, Emmission/Excitation: 494nm/518nm, Application: IF(IHC-P), Synonymns: EC 2.5.1.58; EC=2.5.1.58, 100ul


Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (76107-876)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Application: WB, IHC-P, IF, Conjugate: Alexa Fluor 680, Concentration 1ug/ul, Purification: Purified by Protein A. Synonyms: EC 2.5.1.58; EC=2.5.1.58, Size: 100ul


Catalog Number: (89417-782)
Supplier: Prosci
Description: polyclonal antibody Glutaminase 2 Host: rabbit species reactivity: human mouse rat Isotype: IgG Immunogen: GLS2 Antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2 Application: Western blot


Catalog Number: (10491-240)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Cy5 Conjugated, Isotype: IgG, Emmission/Excitation: 625,650nm/670nm, Application: IF(IHC-P), Synonymns: EC 2.5.1.58; EC=2.5.1.58, 100ul


Catalog Number: (10491-226)
Supplier: Bioss
Description: PGGT1B Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Unconjugated, Isotype: IgG, Application: WB, IHC-P, IF, Synonymns: EC 2.5.1.58; EC=2.5.1.58, 100ul


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,601 - 1,243 of 1,243
no targeter for Bottom