Print…

You Searched For: METTLER TOLEDO(BALANCES) CA


6,716  results were found

Refine Results Sort by
SearchResultCount:"6716"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-76422-456

Anti-CD133 Mouse Monoclonal Antibody [clone: S16015F] (APC (Allophycocyanin))

Supplier: Biolegend
Description: CD133, Monoclonal Antibody, Clone: S16015F, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a, K, Conjugate: APC, Immunogen: Human CD133 transfectants, Other Names: Prominin-1, Formulation: Phosphate-buffered solution, pH 7.2, 0.09% sodium azide 0.2% BSA, Size: 100 Tests

Image Unavailable-76422-514

Anti-CD123 Mouse Monoclonal Antibody [clone: S18016F]

Catalog Number: (76422-514)
Supplier: Biolegend
Description: CD123, Monoclonal Antibody, Clone: S18016F, Host: Mouse, Species Reactivity: Human, Isotype: IgG1, K, Immunogen: Hu CD123 transfectants, Other Names: IL-3RA, IL-3 Receptor alpha, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Size: 100 uG
Image Unavailable-76422-512

Anti-CD123 Mouse Monoclonal Antibody [clone: S18016C]

Catalog Number: (76422-512)
Supplier: Biolegend
Description: CD123, Monoclonal Antibody, Clone: S18016C, Host: Mouse, Species Reactivity: Human, Isotype: IgG1, K, Immunogen: Hu CD123 transfectants, Other Names: IL-3RA, IL-3 Receptor alpha, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Size: 100 uG
Image Unavailable-76422-714

Anti-CD11b Rat Monoclonal Antibody [clone: M1/70] (TotalSeq™-B0014)

Catalog Number: (76422-714)
Supplier: Biolegend
Description: CD11b Monoclonal Antibody, Clone: M1/70, Host: Rat, Species reactivity: Chimpanzee, Baboon, Cynomolgus, Isotype: IgG2b, K, Conjugate: TotalSeq B0014, Immunogen: C57BL/10 splenocytes, Formulation: Phosphate-buffered solution, Synonyms: AM integrin, Mac-1, Mo1, Application: FC, Size: 10 ug
Image Unavailable-CA008-0605

Horse F(ab) IgG Isotype Control (Biotin)

Catalog Number: (CA008-0605)
Supplier: Rockland Immunochemical
Description: 1mg. Antibody Concentration: 1 mg/mL. Biotin/Protein Ratio: 10-20 BAC molecules per Horse IgG molecule. Buffer: 0.02M potassium phosphate, 0.15M sodium chloride, pH 7.2. Stabilizer: 10 mg/mL BSA IgG and Protease free. For research. Lyophilized.
Image Unavailable-CAKIB004

Anti-IgG Rabbit Polyclonal Antibody (Biotin)

Catalog Number: (CAKIB004)
Supplier: Rockland Immunochemical
Description: 1.0ml liquid (sterile filtered). Antibody Concentration: 1.0 mg/ml (by UV absorbance at 280 nm). Buffer: 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2. Stabilizer: 10 mg/ml Bovine Serum Albumin (BSA) IgG and Protease free, 50% (v/v) Glycerol
Image Unavailable-76422-242

Anti-F4/80 Mouse Recombinant Antibody [clone: QA17A29]

Catalog Number: (76422-242)
Supplier: Biolegend
Description: F4/80, Recombinant Monoclonal Antibody, Clone: QA17A29, Host: Mouse, Species Reactivity: Mouse, Isotype: IgG1, K, Immunogen: Murine macrophages, Other Names: EMR1, Ly71, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Size: 500 uG
Image Unavailable-76422-482

Anti-CD14 Mouse Recombinant Antibody [clone: QA18A22]

Catalog Number: (76422-482)
Supplier: Biolegend
Description: CD14, Recombinant Monoclonal Antibody, Clone: QA18A22, Host: Mouse, Species Reactivity: Human, Isotype: IgG1, K, Immunogen: Proprietary, Other Names: LPS receptor, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Application: FC, Size: 100 uG
Image Unavailable-76422-272

Anti-CD267 (TACI) Mouse Monoclonal Antibody [clone: 11H3]

Catalog Number: (76422-272)
Supplier: Biolegend
Description: CD267, Monoclonal Antibody, Clone: 11H3, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a, K, Immunogen: Human TACI transfected cells, Other Names: TACI, TNFRSF13B, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Application: FC, Size: 100 uG
Image Unavailable-76422-226

Anti-CD40 Armenian hamster Monoclonal Antibody [clone: HM40-3] (Ultra-LEAF™)

Catalog Number: (76422-226)
Supplier: Biolegend
Description: CD40 Monoclonal Antibody, Purified, Clone: HM40-3, Host: Armenian Hamster, Species: Mouse, Isotype: IgM, Immunogen: (BALB/c x NZB)F1 mouse-derived lymphoma, Formulation: 0.2um filtered in phosphate solution, Synonym: TNFRSF5, Storage: between 2 deg C and 8 deg C, Application: FC, Size: 100 ug
Product Image-10102-362

Anti-RTCA Rabbit Polyclonal Antibody

Catalog Number: (10102-362)
Supplier: Prosci
Description: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]).
Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102997-404

Kemptide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc
Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:5-FAM-LRRASLG
MW:1130.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-76422-190

Anti-CD7 Mouse Monoclonal Antibody [clone: 4H9/CD7] (PE (Phycoerythrin))

Supplier: Biolegend
Description: CD7, Monoclonal Antibody, Clone: 4H9/CD7, Host: Mouse, Species Reactivity: Human, Isotype: IgG2a, K, Conjugate: PE, Immunogen: T-ALL blast cells, Other Names: gp40, Formulation: Phosphate-buffered solution, pH 7.2, 0.09% sodium azide and 0.2% (w/v) BSA, Size: 25 Tests

Image Unavailable-76422-446

Anti-CD127 (IL-7Ralpha) Rat Monoclonal Antibody [clone: S18006K]

Catalog Number: (76422-446)
Supplier: Biolegend
Description: CD127, Monoclonal Antibody, Clone: S18006K, Host: Rat, Species Reactivity: Mouse, Isotype: IgG, Immunogen: mouse IL7R-transfectants, Other Names: IL-7 receptor A chain, IL-7RA, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Size: 500 uG
Image Unavailable-76422-652

Anti-CD20 Rat Monoclonal Antibody [clone: SA271G2] (PE (Phycoerythrin))

Supplier: Biolegend
Description: CD20, Monoclonal Antibody, Clone: SA271G2, Host: Rat, Species Reactivity: Mouse, Isotype: IgG2b, K, Conjugate: PE, Immunogen: Mouse CD20 transfected cells, Other Names: Ms4a1, Ly-44, Formulation: Phosphate-buffered solution, pH 7.2, containing 0.09% sodium azide, Size: 25 uG

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
513 - 528 of 6,716
no targeter for Bottom