You Searched For: Sulfo-NHS-SS-Biotin


22,736  results were found

SearchResultCount:"22736"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (89262-118)
Supplier: Genetex
Description: Rat Monoclonal antibody to Rat IgG1 isotype control Conjugation: Biotin Tested Applications: ELISA FACS Pkg Size: 100 ug


Catalog Number: (102996-412)
Supplier: Anaspec Inc
Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (CA11029-302)
Supplier: Rockland Immunochemical
Description: Anti-Carboxypeptidase A (Rabbit) Antibody Biotin Conjugated - Anti-Carboxypeptidase A Has Been Assayed Against 1Ug Of Carboxypeptidase A In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (CA11028-886)
Supplier: Rockland Immunochemical
Description: Anti-Trypsin (Rabbit) Antibody Biotin Conjugated - Anti-Trypsin Antibody Is Suitable For Western Blotting And For Elisa. Researchers Should Determine Optimal Titers For Applications That Are Not Stated Below.


Catalog Number: (89277-106)
Supplier: Genetex
Description: Rat Monoclonal antibody to Rat IgG2c isotype control Conjugation: Biotin Tested Applications: ELISA FACS Pkg Size: 100 ug


Catalog Number: (10065-468)
Supplier: Columbia Biosciences
Description: Polyclonal antibody, Rabbit anti-S tag IgG conjugated to Biotin, 100ug, For Western blot detection.

SDS


Catalog Number: (CA11029-074)
Supplier: Rockland Immunochemical
Description: Anti-Glutamate Dehydrogenase (Bovine Liver) (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1 Ug Of Glutamate Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Supplier: Rockland Immunochemical
Description: Anti-Beta Galactosidase (E.Coli) (Rabbit) Antibody Biotin Conjugated - Suitable For Immunoblotting, ELISA, Immunohistochemistry, Immunomicroscopy As Well As Other Antibody Based Assays Using Streptavidin.

Supplier: Biotium
Description: Biotinylated probes for detection of His-tagged proteins.

Supplier: G-Biosciences
Description: The use of biotin for non-radioactive labeling of proteins and nucleic acids has now become an increasingly popular technique in life science research

Supplier: Ricca Chemical
Description: 1.15 g/L. APHA for BOD. Container: Plastic.
Catalog Number: (RC694.7-16)
Supplier: Ricca Chemical
Description: Ammonium thiocyanate 0.025 N (N/40)

Catalog Number: (RC62416)
Supplier: Ricca Chemical
Description: 2% (w/v) Aqueous (20 g/L). ASTM D 1783, for Phenolic Compounds in Water. Container: Plastic.

Catalog Number: (103008-716)
Supplier: Anaspec Inc
Description: This peptide is of Histone H4 (1-23) biotinylated through a GGK linker on the C-terminus. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GGK(Biotin)-NH2
MW:2828.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (89292-548)
Supplier: Genetex
Description: Rat Monoclonal antibody to Rat IgM isotype control Conjugation: Biotin Tested Applications: ELISA FACS Pkg Size: 50 ug


Supplier: Thermo Scientific Chemicals
Description: Ammonium formate ≥98%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,057 - 1,072 of 22,736
no targeter for Bottom